KEGG   Pteropus alecto (black flying fox): 102891515
Entry
102891515         CDS       T02993                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04022  cGMP-PKG signaling pathway
pale04024  cAMP signaling pathway
pale04062  Chemokine signaling pathway
pale04071  Sphingolipid signaling pathway
pale04072  Phospholipase D signaling pathway
pale04144  Endocytosis
pale04150  mTOR signaling pathway
pale04270  Vascular smooth muscle contraction
pale04310  Wnt signaling pathway
pale04350  TGF-beta signaling pathway
pale04360  Axon guidance
pale04510  Focal adhesion
pale04520  Adherens junction
pale04530  Tight junction
pale04611  Platelet activation
pale04621  NOD-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04660  T cell receptor signaling pathway
pale04670  Leukocyte transendothelial migration
pale04722  Neurotrophin signaling pathway
pale04810  Regulation of actin cytoskeleton
pale04921  Oxytocin signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04972  Pancreatic secretion
pale05100  Bacterial invasion of epithelial cells
pale05132  Salmonella infection
pale05133  Pertussis
pale05135  Yersinia infection
pale05152  Tuberculosis
pale05163  Human cytomegalovirus infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102891515 (RHOA)
   04015 Rap1 signaling pathway
    102891515 (RHOA)
   04310 Wnt signaling pathway
    102891515 (RHOA)
   04350 TGF-beta signaling pathway
    102891515 (RHOA)
   04072 Phospholipase D signaling pathway
    102891515 (RHOA)
   04071 Sphingolipid signaling pathway
    102891515 (RHOA)
   04024 cAMP signaling pathway
    102891515 (RHOA)
   04022 cGMP-PKG signaling pathway
    102891515 (RHOA)
   04150 mTOR signaling pathway
    102891515 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102891515 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102891515 (RHOA)
   04520 Adherens junction
    102891515 (RHOA)
   04530 Tight junction
    102891515 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102891515 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102891515 (RHOA)
   04621 NOD-like receptor signaling pathway
    102891515 (RHOA)
   04625 C-type lectin receptor signaling pathway
    102891515 (RHOA)
   04660 T cell receptor signaling pathway
    102891515 (RHOA)
   04670 Leukocyte transendothelial migration
    102891515 (RHOA)
   04062 Chemokine signaling pathway
    102891515 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102891515 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    102891515 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102891515 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    102891515 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102891515 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    102891515 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891515 (RHOA)
   05206 MicroRNAs in cancer
    102891515 (RHOA)
   05205 Proteoglycans in cancer
    102891515 (RHOA)
   05203 Viral carcinogenesis
    102891515 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102891515 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102891515 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102891515 (RHOA)
   05135 Yersinia infection
    102891515 (RHOA)
   05133 Pertussis
    102891515 (RHOA)
   05152 Tuberculosis
    102891515 (RHOA)
   05100 Bacterial invasion of epithelial cells
    102891515 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102891515 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102891515 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pale04147]
    102891515 (RHOA)
   04031 GTP-binding proteins [BR:pale04031]
    102891515 (RHOA)
Membrane trafficking [BR:pale04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    102891515 (RHOA)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102891515 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   102891515 (RHOA)
  Exosomal proteins of colorectal cancer cells
   102891515 (RHOA)
  Exosomal proteins of bladder cancer cells
   102891515 (RHOA)
GTP-binding proteins [BR:pale04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    102891515 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 102891515
NCBI-ProteinID: XP_006909154
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatcaggaagaaattggtgattgttggtgatggagcctgtggcaagacctgc
ttgcttatcgtttttagcaaggaccagtttccagaggtgtatgtacccacagtgtttgag
aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcttgaggcccctctcctacccggacactgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccggaagtcaagcatttctgtcccaatgtgcccatcatcctggttggaaacaagaaggac
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtaaaa
ccagaagaaggcagagatatggcgaacaggattggcgcttttgggtacatggagtgttca
gcaaaaaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system