Pteropus alecto (black flying fox): 102891515 Help Entry 102891515         CDS       T02993                                  Gene name RHOA Definition (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism pale  Pteropus alecto (black flying fox) Pathway pale04014   Ras signaling pathway pale04015   Rap1 signaling pathway pale04022   cGMP-PKG signaling pathway pale04024   cAMP signaling pathway pale04062   Chemokine signaling pathway pale04071   Sphingolipid signaling pathway pale04072   Phospholipase D signaling pathway pale04144   Endocytosis pale04150   mTOR signaling pathway pale04270   Vascular smooth muscle contraction pale04310   Wnt signaling pathway pale04350   TGF-beta signaling pathway pale04360   Axon guidance pale04510   Focal adhesion pale04520   Adherens junction pale04530   Tight junction pale04611   Platelet activation pale04621   NOD-like receptor signaling pathway pale04625   C-type lectin receptor signaling pathway pale04660   T cell receptor signaling pathway pale04670   Leukocyte transendothelial migration pale04722   Neurotrophin signaling pathway pale04810   Regulation of actin cytoskeleton pale04921   Oxytocin signaling pathway pale04928   Parathyroid hormone synthesis, secretion and action pale04972   Pancreatic secretion pale05100   Bacterial invasion of epithelial cells pale05132   Salmonella infection pale05133   Pertussis pale05135   Yersinia infection pale05152   Tuberculosis pale05163   Human cytomegalovirus infection pale05200   Pathways in cancer pale05203   Viral carcinogenesis pale05205   Proteoglycans in cancer pale05206   MicroRNAs in cancer pale05210   Colorectal cancer pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102891515 (RHOA)    04015 Rap1 signaling pathway     102891515 (RHOA)    04310 Wnt signaling pathway     102891515 (RHOA)    04350 TGF-beta signaling pathway     102891515 (RHOA)    04072 Phospholipase D signaling pathway     102891515 (RHOA)    04071 Sphingolipid signaling pathway     102891515 (RHOA)    04024 cAMP signaling pathway     102891515 (RHOA)    04022 cGMP-PKG signaling pathway     102891515 (RHOA)    04150 mTOR signaling pathway     102891515 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102891515 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102891515 (RHOA)    04520 Adherens junction     102891515 (RHOA)    04530 Tight junction     102891515 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102891515 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102891515 (RHOA)    04621 NOD-like receptor signaling pathway     102891515 (RHOA)    04625 C-type lectin receptor signaling pathway     102891515 (RHOA)    04660 T cell receptor signaling pathway     102891515 (RHOA)    04670 Leukocyte transendothelial migration     102891515 (RHOA)    04062 Chemokine signaling pathway     102891515 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     102891515 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     102891515 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102891515 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     102891515 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102891515 (RHOA)   09158 Development and regeneration    04360 Axon guidance     102891515 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102891515 (RHOA)    05206 MicroRNAs in cancer     102891515 (RHOA)    05205 Proteoglycans in cancer     102891515 (RHOA)    05203 Viral carcinogenesis     102891515 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     102891515 (RHOA)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102891515 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102891515 (RHOA)    05135 Yersinia infection     102891515 (RHOA)    05133 Pertussis     102891515 (RHOA)    05152 Tuberculosis     102891515 (RHOA)    05100 Bacterial invasion of epithelial cells     102891515 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102891515 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pale04131]     102891515 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pale04147]     102891515 (RHOA)    04031 GTP-binding proteins [BR:pale04031]     102891515 (RHOA) Membrane trafficking [BR:pale04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102891515 (RHOA) Exosome [BR:pale04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102891515 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102891515 (RHOA)   Exosomal proteins of colorectal cancer cells    102891515 (RHOA)   Exosomal proteins of bladder cancer cells    102891515 (RHOA) GTP-binding proteins [BR:pale04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102891515 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA Motif Other DBs NCBI-GeneID:  102891515 NCBI-ProteinID:  XP_006909154 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaattggtgattgttggtgatggagcctgtggcaagacctgc ttgcttatcgtttttagcaaggaccagtttccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcccctctcctacccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtcccaatgtgcccatcatcctggttggaaacaagaaggac cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtaaaa ccagaagaaggcagagatatggcgaacaggattggcgcttttgggtacatggagtgttca gcaaaaaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system