KEGG   Pteropus alecto (black flying fox): 102891552
Entry
102891552         CDS       T02993                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04072  Phospholipase D signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04630  JAK-STAT signaling pathway
pale04810  Regulation of actin cytoskeleton
pale05160  Hepatitis C
pale05165  Human papillomavirus infection
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05226  Gastric cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102891552 (EGF)
   04012 ErbB signaling pathway
    102891552 (EGF)
   04014 Ras signaling pathway
    102891552 (EGF)
   04015 Rap1 signaling pathway
    102891552 (EGF)
   04630 JAK-STAT signaling pathway
    102891552 (EGF)
   04066 HIF-1 signaling pathway
    102891552 (EGF)
   04068 FoxO signaling pathway
    102891552 (EGF)
   04020 Calcium signaling pathway
    102891552 (EGF)
   04072 Phospholipase D signaling pathway
    102891552 (EGF)
   04151 PI3K-Akt signaling pathway
    102891552 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102891552 (EGF)
   04540 Gap junction
    102891552 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102891552 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891552 (EGF)
   05231 Choline metabolism in cancer
    102891552 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102891552 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102891552 (EGF)
   05212 Pancreatic cancer
    102891552 (EGF)
   05226 Gastric cancer
    102891552 (EGF)
   05214 Glioma
    102891552 (EGF)
   05218 Melanoma
    102891552 (EGF)
   05219 Bladder cancer
    102891552 (EGF)
   05215 Prostate cancer
    102891552 (EGF)
   05213 Endometrial cancer
    102891552 (EGF)
   05224 Breast cancer
    102891552 (EGF)
   05223 Non-small cell lung cancer
    102891552 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102891552 (EGF)
   05165 Human papillomavirus infection
    102891552 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102891552 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102891552 (EGF)
Cytokines and growth factors [BR:pale04052]
 Growth factors
  Growth factors (RTK binding)
   102891552 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b cEGF FXa_inhibition EGF_CA DUF5050 EGF EGF_3 Tr-sialidase_C
Other DBs
NCBI-GeneID: 102891552
NCBI-ProteinID: XP_006918982
LinkDB
Position
Unknown
AA seq 1207 aa
MLLFLVILLPVVFKFGFVSLSALPRWNCPEESPSGNGNPACVGPVPFLIFSHGNSIFRID
LEGTNYEKLVTDAGVSVIMDFHYNKERIYWVDLERQLLQRVFLNGTRQERVCNIEKNVSG
MAINWINEELIWSNQQEGIITITDMKGNNSRILLSALKYPANVAVDPVERFIFWSSEVAG
SLQRADLGGVEVKILLETAEKITAMSLDVLGKRLFWVQYDREGSNSRICSCDYDGGSVHF
SKYLSQHNLFAISLFGDRIFYSTWRKKTIWIADKHTGKDMVRINLNSSFVPPGGIKVVHP
IGQPRAEGDAWASDQNFCSLRKGNCRGSVCGQDLKSHLCTCAEGYALSQDGKYCEDVNEC
ALWNHGCTLGCENIPGSYYCTCPVGFVLLPDGKRCHQLISCPSNASECSHECVLTSDGPI
CFCPEGSVLGTDGKTCSGCSSPDNGGCSQLCIPLSPVSWECGCHPGYDLQLDKKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGTVFAIDHDPVENKVYFAHTALKCIERAN
MDGSQRERLIEEAVDVPEGLAIDWIDRKLYWTDRGKSVIEGSDLSGKHREVIIREDISQP
RGIAVHPVAKRLFWTDMGINPRIESSSLQGVGRLVIASSELVWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRQRLAQNDVGHPFAVAVFEDHVWFSDWTVPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKEKFGAVQCSCREGFVKAPDGKLC
LALNGHQVLAGSGADLSNQVKPSDMLLSSQGFEDNITESQHVLVAEIMASDDDDCGPMEC
GAHSQCVSEGEVATCQCLKGFAGDGKLCSDIDECEMGITVCPHPSSKCINTEGGHVCQCS
QGYRGDGIHCLDIDECQLGMHTCGENATCTNTEGNYTCTYAGIPSEPGRVCPDSTPPSQL
REDGHYSVRNSYPECPPSHAGYCLHGGVCMYIEAVDNYACNCIVGYVGERCQHRDLKWWE
LRHAGHGRQRSLAVGAVCVLVLVLLLLLGLWGAHCYRTQKLLSKNQKSPYEESCRDPSIS
RPADGEAGVSSCPQPWFVVIKEHQNLRNGDQPVAPRDGQATVADQFFSLEPGSVQLTPWR
KEPQRSLGTEQGCCVPPSSDDRSGPQGMEHSFPLPSYGVQPIVVGVEKPHSLLSANPLRQ
QRAPDSP
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgctgctcttccttgtcattctgttgccggtagtttttaagtttggttttgttagtctc
tcagcactgcctcgctggaactgtcctgaagagtctccctctggaaatgggaatcctgct
tgtgtgggtcctgtacccttcttaattttctctcatggaaatagtatctttcggattgac
ctggaaggaactaattatgagaaattggtgacagatgctggcgtatcagtgatcatggat
tttcattacaataaggaaagaatctattgggtagatctagaaagacaacttttgcaaaga
gttttcctgaatgggacaaggcaagagagagtatgcaatatagagaaaaatgtttcagga
atggcaataaattggataaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acaataacagatatgaaaggaaacaattcccgcattctattaagtgccttaaaatatcct
gcaaatgtagcggttgatccagtagaaaggtttatattttggtcttcagaggtggccggc
agccttcagagggcagatctcggtggtgtggaagtgaagattctgctagagacggcagag
aaaataacagctatgtcgttggatgtgcttggtaaacggctcttctgggttcagtatgac
agagaaggaagcaattctcgtatttgttcctgtgattatgatggaggttctgtccatttt
agcaaatatctttcacagcacaatttgtttgcaatatccctttttggtgaccgtatcttc
tattcaacatggagaaagaagacaatttggatagctgacaaacacactgggaaggatatg
gttagaattaacctcaactcatcatttgtaccacctggaggaattaaagtagtgcacccg
atcggacagcccagggcagagggtgatgcttgggcatctgatcaaaacttctgcagtctg
aggaaaggcaactgcagaggcagcgtgtgtgggcaagaccttaagtcccatttgtgcacg
tgtgcggagggatatgctttaagccaggacggaaagtattgtgaagatgttaatgaatgt
gctctttggaaccatggctgtactcttgggtgtgaaaacatccctggatcctattattgc
acatgccctgtaggatttgttctgcttcctgatggaaaacggtgtcaccagttaatttcc
tgtccaagcaatgcatctgaatgcagccatgagtgcgttctgacttcagatggtcccata
tgtttctgtcctgaaggttcagtgcttgggacagatggaaaaacatgtagtggctgttca
tcacctgataatggtggatgtagccagctctgcatccctctcagcccagtatcttgggaa
tgtggttgccaccctggctatgacctacaactggacaaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagattatggaaccctgctcagccagcaaatgggaacggttttcgccatagatcatgac
cctgtggaaaataaggtatactttgcccatacagccctcaagtgcatagagagagcaaat
atggatggttcccagagagaaaggcttatcgaggaagcagtagatgtgccagaaggtctt
gctatagactggattgaccgtaaactctattggacagacagagggaaatcggtcatagaa
ggcagtgatttaagtggaaaacatcgtgaagtaatcattcgggaagacatctctcagcca
cgaggaattgctgtccatccagtggccaagagattattctggactgatatgggaattaat
ccacgaatcgaaagttcttctcttcaaggcgttggccgactggtcatcgctagctctgag
ctggtctggcccagtggaataacgattgacttcttaaccgacaagttgtattggtgtgat
gccaagcaatctgtgatcgaaatggctaatctggatggttcgaaacgccaaagacttgcc
cagaacgatgtaggtcacccatttgctgtggctgtgtttgaggatcacgtatggttctct
gactggactgtgccatcggtaataagggtgaacaagaggactggcaaaaatagggtacgt
ctccgaggcagcatgctgaagccctcatcactggttgtagttcatccattggcaaaacca
ggagcagatccctgcttatatcaaaatggaggctgtgaacatatttgcaaagagaagttt
ggagctgttcagtgttcgtgtcgtgaaggttttgtgaaagccccagatgggaaactctgt
ctggctctaaatggccatcaggtattggcaggtagtggagcagatctaagtaatcaagta
aagccatcggacatgctactcagcagtcaagggtttgaagataatattacagaatcgcaa
catgtgctagtggccgaaatcatggcatcagatgacgacgactgtggtcccatggagtgt
ggtgcacactctcaatgtgtttcagagggagaggttgccacgtgtcagtgtttgaaagga
tttgctggggatggaaaattatgttctgatatagatgaatgtgagatgggtatcacggtg
tgcccgcacccctcttccaagtgcatcaatactgaaggtggccatgtctgccagtgctca
caaggctaccgaggagatggaattcactgtcttgatattgacgagtgccaactgggcatg
cacacctgtggggaaaatgccacctgtacaaacacagagggaaactacacctgcacgtat
gccggtatcccgtctgaacctggacgggtttgccctgactccactccaccctctcagctc
agggaagatggccactattctgtgaggaacagttacccagaatgccccccgtcccacgct
gggtactgcctccacggcggtgtgtgtatgtacattgaagccgtggacaactacgcatgc
aactgtattgttggctacgtcggggagcgatgtcagcaccgagacttgaaatggtgggaa
ctgcgccacgccggccacgggcggcagcggagcctcgcggtgggggctgtctgcgtgctg
gtgcttgtcctgctgctgctcctggggctgtggggcgctcactgctacaggactcagaag
ctgctatcgaaaaatcagaagagcccttatgaagagtcatgcagagacccaagcatcagc
aggcctgcagacggagaggccggggtgtcttcctgtccccagccttggtttgtggttata
aaggaacaccagaacctcaggaatggggatcaacccgtggctccccgggatggccaggcc
acagttgctgaccagtttttctccctggaacctgggtcagtgcaactgacgccatggagg
aaggaaccccagaggagtctgggcacagagcaaggctgctgcgttccaccatccagtgat
gataggtctggtccccagggaatggagcacagctttcctctcccctcctatggggtgcag
cccattgttgtgggggtcgagaagccccattctctcctgtcagctaaccccttacggcaa
caaagggccccagattcaccatag

KEGG   Pteropus alecto (black flying fox): 102893670
Entry
102893670         CDS       T02993                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A
  KO
K04359  platelet-derived growth factor subunit A
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04072  Phospholipase D signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04630  JAK-STAT signaling pathway
pale04810  Regulation of actin cytoskeleton
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05206  MicroRNAs in cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05231  Choline metabolism in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102893670 (PDGFA)
   04014 Ras signaling pathway
    102893670 (PDGFA)
   04015 Rap1 signaling pathway
    102893670 (PDGFA)
   04630 JAK-STAT signaling pathway
    102893670 (PDGFA)
   04020 Calcium signaling pathway
    102893670 (PDGFA)
   04072 Phospholipase D signaling pathway
    102893670 (PDGFA)
   04151 PI3K-Akt signaling pathway
    102893670 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102893670 (PDGFA)
   04540 Gap junction
    102893670 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102893670 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893670 (PDGFA)
   05202 Transcriptional misregulation in cancer
    102893670 (PDGFA)
   05206 MicroRNAs in cancer
    102893670 (PDGFA)
   05231 Choline metabolism in cancer
    102893670 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    102893670 (PDGFA)
   05218 Melanoma
    102893670 (PDGFA)
   05215 Prostate cancer
    102893670 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102893670 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102893670 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102893670 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102893670 (PDGFA)
Cytokines and growth factors [BR:pale04052]
 Growth factors
  Growth factors (RTK binding)
   102893670 (PDGFA)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102893670 (PDGFA)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 102893670
NCBI-ProteinID: XP_024905339
LinkDB
Position
Unknown
AA seq 191 aa
MRNTPRVALKVQPHRGRRRSGQVCLPRGLPSSPGEDESRPRPWAQSPGGAEDALGSSLRA
HGGRATKHTPEKRLGPVRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVE
VRRCTGCCNTSSVKCQPSRVQHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACAAASPG
PGHREEETDVR
NT seq 576 nt   +upstreamnt  +downstreamnt
atgaggaacacgccgcgtgtggcactgaaagttcagccgcatagagggcgccggcgctcc
ggccaggtgtgcctgccccgcggcctgccctccagcccgggcgaggacgagagccggccc
aggccgtgggcgcagagccctggcggggccgaggacgctctgggaagcagcctgagagcc
cacggcggccgtgccaccaagcacacacctgagaagcggctcgggcccgttcggaggaaa
agaagcatcgaggaggccgtccctgccgtctgcaagaccaggacggtcatctacgagata
cctcggagccaggtcgaccccacgtctgccaacttcctgatctggccgccgtgcgtggag
gtgaggcgctgcaccggctgctgtaacaccagcagcgtcaagtgccagccgtcccgcgtg
cagcaccggagcgtcaaggtggccaaggtggagtacgtgaggaagaagccgaagctgaag
gaagtgcaggtgaggctggaagagcacctggagtgcgcgtgcgcggccgccagcccgggc
ccgggccaccgcgaggaggagacggatgtgaggtga

KEGG   Pteropus alecto (black flying fox): 102897699
Entry
102897699         CDS       T02993                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B isoform X1
  KO
K17386  platelet-derived growth factor subunit B
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04072  Phospholipase D signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04630  JAK-STAT signaling pathway
pale04810  Regulation of actin cytoskeleton
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05211  Renal cell carcinoma
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05231  Choline metabolism in cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102897699 (PDGFB)
   04014 Ras signaling pathway
    102897699 (PDGFB)
   04015 Rap1 signaling pathway
    102897699 (PDGFB)
   04630 JAK-STAT signaling pathway
    102897699 (PDGFB)
   04020 Calcium signaling pathway
    102897699 (PDGFB)
   04072 Phospholipase D signaling pathway
    102897699 (PDGFB)
   04151 PI3K-Akt signaling pathway
    102897699 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102897699 (PDGFB)
   04540 Gap junction
    102897699 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102897699 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102897699 (PDGFB)
   05206 MicroRNAs in cancer
    102897699 (PDGFB)
   05231 Choline metabolism in cancer
    102897699 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    102897699 (PDGFB)
   05218 Melanoma
    102897699 (PDGFB)
   05211 Renal cell carcinoma
    102897699 (PDGFB)
   05215 Prostate cancer
    102897699 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102897699 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102897699 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102897699 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102897699 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102897699 (PDGFB)
Cytokines and growth factors [BR:pale04052]
 Growth factors
  Growth factors (RTK binding)
   102897699 (PDGFB)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102897699 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 102897699
NCBI-ProteinID: XP_006917467
LinkDB
Position
Unknown
AA seq 243 aa
MAGSCSHLSSEQGSLGTNATCHLGDPIPEELYEMLSDHSIRSFDDLQRLLHGDSVDEDGA
ELDLNLTRSHSGGKPESLSRGRRSLDSPTVAEPAMIAECKTRTEVFEISRRLVDRTNANF
LVWPPCVEVQRCSGCCSNRNVQCRPTQVQLRHVQVRKIEIVRKKPSFKKATVTLEDHLAC
KCETVVAARPVTRSPGSSQEQRAKTPQTRMSVRMVRVRRPPKGKHKKFKHTHDKKALKET
LGA
NT seq 732 nt   +upstreamnt  +downstreamnt
atggctggcagctgcagccacctctccagtgagcaaggaagtcttggcacgaatgcaaca
tgccatttgggagaccccatccccgaggagctctacgagatgctgagtgaccactctatc
cgctccttcgatgacctccagcgcctgctgcacggagactccgtagatgaagacggggcc
gaattggacctgaatttgacccggtcccattctggaggcaagccagagagcttatctcga
gggagaaggagcctagattccccgacggtcgccgagccagccatgatcgccgagtgcaag
acgcgcaccgaggtgtttgagatctcccggcgcctcgtcgaccgcaccaacgccaacttc
ctggtgtggccgccctgcgtggaggtgcagcgctgctccggctgctgcagcaatcgcaac
gtgcagtgccgccccacccaggtgcagctgcgccacgtccaggtgagaaagatcgagatt
gtgaggaagaagccgagctttaagaaggccacagtgactctggaggaccacctggcatgc
aagtgtgagacggtggtggccgcaagacctgtgacccgaagcccagggagttcccaggag
cagcgagccaaaacgccccaaactcggatgagcgttaggatggtgcgagtccgccggccc
cccaaggggaagcacaagaagttcaagcacacgcatgacaagaaggcgctgaaggagacc
cttggagcctag

DBGET integrated database retrieval system