KEGG   Pteropus alecto (black flying fox): 102891826
Entry
102891826         CDS       T02993                                 

Gene name
PIM1
Definition
(RefSeq) serine/threonine-protein kinase pim-1
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04630  JAK-STAT signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102891826 (PIM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102891826 (PIM1)
   05206 MicroRNAs in cancer
    102891826 (PIM1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102891826 (PIM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102891826 (PIM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102891826 (PIM1)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102891826 (PIM1)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   102891826 (PIM1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Choline_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 102891826
NCBI-ProteinID: XP_006907371
UniProt: L5L0J7
LinkDB
Position
Unknown
AA seq 313 aa
MLLSKINSLAHLRTAPCNDLHSTKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVAD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPSFEEIQNHPWMQDVLLPQETA
EIHLHSLLPGPSK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgctcctgtccaaaattaactcccttgcccacctgcgcacggcgccctgcaacgacctg
cactccaccaagctggcgccgggcaaggagaaggagcccctggagtcgcaataccaggtg
ggcccgctactgggcagcggcggcttcggctcggtctactcaggcatccgtgtcgccgac
aacttgccggtggccatcaagcacgtggagaaggaccggatttccgactggggagagctg
cccaatggcacccgagtgcccatggaagtggtcttgctgaagaaggtgagctcaggcttc
tccggcgtcattagactcctggactggttcgagaggcccgacagtttcgtcctgatcctg
gagcggcccgagccggtgcaagacctcttcgactttatcacggaaaggggggccctacaa
gaagagctggcccgcagcttcttctggcaggtgctggaggccgtgcggcactgccacaac
tgcggggtgctccaccgcgacatcaaggacgagaacatcctcatcgacctcaatcgcggc
gagctcaagctcatcgacttcgggtcgggagcgctgctcaaggacaccgtctatacggat
ttcgatgggacccgagtgtatagtcctccagagtggatccgctaccatcgctaccacggc
aggtcggcagctgtctggtctctggggatcctgctgtatgatatggtctgtggagatatt
ccttttgagcacgatgaggagatcatcaggggccaagttttcttcaggcagagggtctct
tcagagtgtcagcatctcattagatggtgcttggccctgagaccatcagatcggccatcc
ttcgaagaaatccagaatcatccatggatgcaagatgtcctccttccccaggaaactgct
gagatccatctccacagcctgttgccagggcccagcaaatag

DBGET integrated database retrieval system