KEGG   Pteropus alecto (black flying fox): 102892511
Entry
102892511         CDS       T02993                                 

Gene name
FADD
Definition
(RefSeq) FAS-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04217  Necroptosis
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04622  RIG-I-like receptor signaling pathway
pale04657  IL-17 signaling pathway
pale04668  TNF signaling pathway
pale05010  Alzheimer disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05142  Chagas disease
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102892511 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102892511 (FADD)
   04215 Apoptosis - multiple species
    102892511 (FADD)
   04217 Necroptosis
    102892511 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102892511 (FADD)
   04621 NOD-like receptor signaling pathway
    102892511 (FADD)
   04622 RIG-I-like receptor signaling pathway
    102892511 (FADD)
   04657 IL-17 signaling pathway
    102892511 (FADD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102892511 (FADD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102892511 (FADD)
   05022 Pathways of neurodegeneration - multiple diseases
    102892511 (FADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102892511 (FADD)
   05152 Tuberculosis
    102892511 (FADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102892511 (FADD)
   05161 Hepatitis B
    102892511 (FADD)
   05160 Hepatitis C
    102892511 (FADD)
   05164 Influenza A
    102892511 (FADD)
   05162 Measles
    102892511 (FADD)
   05168 Herpes simplex virus 1 infection
    102892511 (FADD)
   05163 Human cytomegalovirus infection
    102892511 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102892511 (FADD)
   05169 Epstein-Barr virus infection
    102892511 (FADD)
   05165 Human papillomavirus infection
    102892511 (FADD)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102892511 (FADD)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102892511 (FADD)
SSDB
Motif
Pfam: Death DED tRNA_NucTran2_2
Other DBs
NCBI-GeneID: 102892511
NCBI-ProteinID: XP_006911354
LinkDB
Position
Unknown
AA seq 205 aa
MDPFLVLLHSVSASLSSGELTELKFLCQGRVGKRKLERVQSGVDLFSVLLEQNELDPHHT
ELLRELLTSLRRQDLLRLIFSRPLPPRPDLYAAFDIICDHVGKDWRRLARQLKVSDSKID
AIEMKYPRNLTEQVRESLRVWKSSRREDAAVSQLVEALRACRLNLVADHVEEAQQARGLQ
SESESASGSVSPVSWGSDAPASRAC
NT seq 618 nt   +upstreamnt  +downstreamnt
atggacccgttcctggtgctgctgcactcggtgtcggccagcctgtcgagcggcgagctg
acggagctcaagttcctgtgccagggccgcgtgggcaagaggaagctggagcgcgtgcag
agcggcgtcgacctcttctccgtgctgctcgagcagaacgagctggacccgcaccacacc
gagctgctgcgcgagctgctcacgtccctgcggcgccaggacctgctgcggctcattttc
tctcgccccctgcccccccgcccagacctgtatgcggcattcgacatcatatgtgatcac
gtggggaaagactggagaagactggcccgtcagctgaaagtgtctgacagcaagatcgac
gccatcgagatgaagtacccccgcaacctgacggagcaggtgagggagtcgctgagagtc
tggaagagcagccggcgggaggacgcggcggtgtcccagctggtggaggcgctgcgggcc
tgccggctcaacctggtggcggaccacgtcgaggaggcgcagcaggcccggggcctccag
agcgagagcgagagtgccagcggctctgtgtccccagtgtcctggggctcggacgccccc
gcctccagagcctgctga

DBGET integrated database retrieval system