KEGG   Pteropus alecto (black flying fox): 102892591
Entry
102892591         CDS       T02993                                 

Gene name
BBC3
Definition
(RefSeq) bcl-2-binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04115  p53 signaling pathway
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04390  Hippo signaling pathway
pale05016  Huntington disease
pale05162  Measles
pale05200  Pathways in cancer
pale05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102892591 (BBC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102892591 (BBC3)
   04215 Apoptosis - multiple species
    102892591 (BBC3)
   04115 p53 signaling pathway
    102892591 (BBC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102892591 (BBC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102892591 (BBC3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102892591 (BBC3)
  09172 Infectious disease: viral
   05162 Measles
    102892591 (BBC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102892591 (BBC3)
SSDB
Motif
Pfam: PUMA
Other DBs
NCBI-GeneID: 102892591
NCBI-ProteinID: XP_024902487
LinkDB
Position
Unknown
AA seq 153 aa
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAFLC
APTAPPTATAALGGPRWPAGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALARQEQ
QRHRPAPWRVLYDLIMGLLPLPRGRGTPEMEPN
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcccgagcacgccaggagggcagctccccggagcccgtagagggcctggcccgagac
ggcccgcgccccttcccgctcagccgcctggtgccctcggctgtgtcctgcggcctctgc
gagcccggcctgcctgccgcccccgccgcccctgcactgctgcccgctgccttcctctgc
gcccccactgccccgcccaccgccaccgctgccctggggggcccccgctggcctgcgggt
ccccgcagcaggccccgaggcccgcgccccgacggtcctcagccctcgctgtcgcccgcg
gagcagcacctggaatcgccggtgcccagcgccccgggggccctggcgagacaagagcag
cagcgacaccgccctgcaccctggagggtcctgtacgatctcatcatgggactgctgccc
ttacccaggggccgtgggacccccgagatggagcccaactag

DBGET integrated database retrieval system