KEGG   Pteropus alecto (black flying fox): 102892712
Entry
102892712         CDS       T02993                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X2
  KO
K05771  glucocorticoid receptor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102892712 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102892712 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pale03310]
    102892712 (NR3C1)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102892712 (NR3C1)
Nuclear receptors [BR:pale03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102892712 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 102892712
NCBI-ProteinID: XP_006923035
LinkDB
Position
Unknown
AA seq 776 aa
MDPKESLSPPSREEIPSSVLGRERGNVMDFYKTLRGGATVKVSASSSSLAAASQSDSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
RLLEESIANLNKSTSVPENPKSSASAAVSAAPTEEFPKTHSDVSSEQQNLKSQTGTNGGN
VKLYNTDQRTFDILQDLEFSSGSPGKETNESPWRSDLLIDDNCLLSPLTGEDDPFLLEGN
SNEDCKPPVLPDTKPKIKDNGDLILSSPSSVTLPQVKTEKEDFIELCTPGVIKQEKLGPV
YCQAGFSGANIIGNKISAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPVFNVIPPIPAG
SENWNRCQGSGDDNLTSLGTLNFPGRSVFSNGYSSPGMRPDVSSPPSSSSAAAGPPPKLC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKC
LQAGMNLEARKTKKKIKGIQQATTGISQETSENPANKTIVPATLPQLTPTLVSLLEVIEP
EVLYAGYDSSAPDSTWRIMSTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMILLQYSWM
FLMAFALGWRSYRQSSANLLCFAPDLIINEQRMALPCMYDQCKHMLFVSSELNRLQVSYE
EYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKL
LDSMHEVVENLLHYCFQTFLDKSMSIEFPEMLAEIITNQLPKYSSGNIKKLLFHQK
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggaccccaaggaatcattaagcccacccagtagagaagaaatccccagcagtgtgctt
ggtcgggagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtg
aaggtttctgcatcttcatcctcactggctgctgcttctcagtcagactctaagcagcaa
cgacttttggttgattttccaaaaggctcaggaagcaatgcgcagcagccagatctgtcc
aaagcagtttcactctcaatgggactgtatatgggagagacagaaacaaaagtaatggga
aatgacctgggattcccacagcagggccaaataagcctttcctctggggaaacagatttt
cggcttctggaagaaagtatcgcaaacctcaataagtcgaccagtgttccagagaacccc
aagagttcagcatcagctgctgtttctgctgcccccacagaggagtttccaaaaacacac
tccgatgtgtcttcagaacagcagaatttgaagagccagaccggcaccaatgggggcaat
gtgaagctgtataacacagaccaaagaacctttgacattttgcaggatttggagttttct
tctgggtccccaggaaaagagacaaatgagagtccttggagatcagacctcttgatagat
gacaattgtttgctttctcctttgacaggagaggatgatccattccttttggaaggaaac
tcgaatgaggactgtaagcctcctgttttaccggacactaaacctaaaattaaagataat
ggagatctgatcttatcaagccccagcagtgtaacactgccccaagtgaaaacagaaaaa
gaagatttcattgaactctgcacccctggagtaattaagcaagagaaactgggcccagtt
tactgtcaggcaggcttttctggggcaaatataattggtaataaaatatctgccatttct
gttcacggcgtgagtacctctgggggacagatgtaccactatgacatgaatacagcatcc
ctttctcagcagcaggatcagaagcctgtttttaatgtcattccaccaatccctgctggt
tcagaaaattggaataggtgccaaggatctggagatgacaacttgacttccttggggact
ttgaacttccctggtcgatctgtcttttctaatggctattcaagccctggaatgagacca
gatgtaagctctcctccatccagctcctcagcagcagcgggaccacctcccaaactctgc
cttgtgtgctctgatgaagcttcaggatgtcattatggggtcttgacttgtggaagctgt
aaagtcttcttcaaaagagcagtggaaggacagcacaattatctttgtgctggaagaaat
gattgtatcattgacaaaattagaagaaaaaactgcccagcatgccgttatcgaaaatgt
cttcaagctggaatgaacctggaagctcgaaaaacaaagaaaaagataaaaggaattcag
caggccactacaggaatctcacaagaaacctctgaaaatcccgccaacaaaacaatagtt
cctgcaacactgccgcaactcacgcccaccctggtgtcactgttggaggtcatcgaacct
gaggtgttatatgcaggctatgacagctctgctccagattcgacatggcggatcatgagc
acgcttaatatgttaggcgggcggcaagtgattgcagcagtgaaatgggccaaggcgata
ccaggattcaggaacttacacctggatgaccaaatgatcctactgcaatattcatggatg
ttcctcatggcatttgccctgggatggagatcatatagacagtcaagtgcaaacctgctg
tgttttgctcctgacttgattattaatgagcagaggatggctctaccctgcatgtatgac
caatgcaaacacatgctgtttgtttcctctgagttaaacaggcttcaggtatcttatgaa
gagtatctctgcatgaaaaccttactgcttctctcttcagttcctaaggaaggtttgaag
agccaagaactatttgatgaaatcagaatgacctacatcaaagagctagggaaagccatt
gtcaagagggaaggaaactccagtcagaactggcagcggttttatcagctgactaaactc
ttggactccatgcatgaggtggttgaaaatctccttcactattgcttccaaacatttttg
gataagtctatgagtattgaattcccagagatgttagctgaaatcatcaccaaccagtta
ccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system