KEGG   Pteropus alecto (black flying fox): 102892713
Entry
102892713         CDS       T02993                                 

Gene name
EGR1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04371  Apelin signaling pathway
pale04912  GnRH signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05020  Prion disease
pale05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102892713 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102892713 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    102892713 (EGR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    102892713 (EGR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102892713 (EGR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102892713 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102892713 (EGR1)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    102892713 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Zf_RING zf-BED zf-C2H2_8 zf-H2C2_5
Other DBs
NCBI-GeneID: 102892713
NCBI-ProteinID: XP_006923125
UniProt: L5JX27
LinkDB
Position
Unknown
AA seq 537 aa
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLSAAGAPEGSSG
GSNGSSGGGGGGSSSSSAFNPQGEAGEQPYEHLTSESFPDISLNNEKVLVETSYPSQTTR
LPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPATSSSAPSPAASSSSSASQ
SPPLSCAVQSSDSSPIYSAAPTFPTPNTDIFPEPQSQAYPGSAGTALQYPPPAYPAAKGS
FQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKA
LNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQK
PFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKA
DKGVVASSATPSLSSYSSPVATSYTSPVTTSYPSSATTSYPSPVPTSYSSPGSSTYPSPV
HSGFPSPSVATTYSSVPPAFPAQVSSFPSSSVTNSFSASTGLSDMTTTFSPRTIEIC
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggccgcagccaaggccgagatgcagctgatgtccccactgcagatttccgacccgttc
ggctcctttcctcactcgcccaccatggacaactatcctaaactggaggagatgatgctg
ctgagcaacggggctccccagttcctcagtgccgccggggcccccgaggggagcagcggt
ggcagcaacggcagcagcggtggaggtggagggggcagcagcagcagcagcgccttcaac
cctcaaggggaggcgggtgagcagccctacgagcacctgacctcagagtcttttcctgac
atctctctgaataacgagaaggttctggtggagacaagttaccccagccaaaccacccgg
ctgccccccatcacctacaccggccgcttctctctggagcctgcgcccaacagtggcaac
actttgtggcctgagcccctcttcagcctggtcagcggcctcgtgagcatgaccaaccca
ccggccacctcatcctcagcaccatctccagcggcctcctcttcatcctcagcctctcag
agtccacccctgagctgtgcggtgcaatccagtgacagcagccccatttactcagcggca
cccacctttcccacgcctaacactgatatcttccctgagccacagagccaggcctatcct
ggctcggcaggtactgcgctccagtacccacctcctgcctaccctgctgccaagggtagt
ttccaggtccctatgattcctgactatctgtttccacaacagcagggggacctgggccta
ggcaccccagaccagaagcccttccagggcctggagagccgcacccagcagccttcactc
actccactctctaccatcaaggcctttgccacacagtccggctcccaagacctgaaggct
ctcaacacgacttaccagtcccagctcatcaaacccagccgcatgcgcaaataccctaac
cggcccagcaagacacccccccacgaacgcccttatgcctgtcccgtagagtcctgtgac
cgccgcttctcccgttcagatgagctcacccgccacattcgcatccacactggccagaag
cccttccagtgtcgcatttgcatgcgcaacttcagccgcagtgaccacctcaccactcac
atccgcacccacacaggagagaagcccttcgcctgtgacatctgtgggaggaaatttgcc
aggagcgatgaacgcaaaaggcataccaagatccacttgcggcaaaaggacaaaaaagca
gacaaaggtgttgtggcctcttctgccaccccctccctctcttcctactcctcgccagtg
gctacctcctatacctccccagtcactacctcttacccatcctcagccaccacttcatac
ccatcacctgtgcccacctcctactcttctcctggctcctccacctacccatcccctgtg
cacagtggtttcccctcaccctcagtggccaccacatactcctctgttccccctgctttc
cctgcccaagtcagcagcttcccttcttcatctgtcaccaactccttcagcgcctccaca
gggctttcggacatgacaacaacattttctcccaggacaattgaaatttgctaa

DBGET integrated database retrieval system