KEGG   Pteropus alecto (black flying fox): 102893019
Entry
102893019         CDS       T02993                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04110  Cell cycle
pale04218  Cellular senescence
pale04934  Cushing syndrome
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05212  Pancreatic cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102893019 (RB1)
   04218 Cellular senescence
    102893019 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893019 (RB1)
   05203 Viral carcinogenesis
    102893019 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102893019 (RB1)
   05225 Hepatocellular carcinoma
    102893019 (RB1)
   05226 Gastric cancer
    102893019 (RB1)
   05214 Glioma
    102893019 (RB1)
   05220 Chronic myeloid leukemia
    102893019 (RB1)
   05218 Melanoma
    102893019 (RB1)
   05219 Bladder cancer
    102893019 (RB1)
   05215 Prostate cancer
    102893019 (RB1)
   05224 Breast cancer
    102893019 (RB1)
   05222 Small cell lung cancer
    102893019 (RB1)
   05223 Non-small cell lung cancer
    102893019 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102893019 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102893019 (RB1)
   05161 Hepatitis B
    102893019 (RB1)
   05160 Hepatitis C
    102893019 (RB1)
   05163 Human cytomegalovirus infection
    102893019 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102893019 (RB1)
   05169 Epstein-Barr virus infection
    102893019 (RB1)
   05165 Human papillomavirus infection
    102893019 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102893019 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102893019 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102893019 (RB1)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102893019 (RB1)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    102893019 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1
Other DBs
NCBI-GeneID: 102893019
NCBI-ProteinID: XP_006916505
UniProt: L5KEH9
LinkDB
Position
Unknown
AA seq 925 aa
MPPKAPRRVATASAAAPPAPPPPPPTEEDPEQDSGPEDLPLARLEFEETEEPDFTALCQK
LKIPDHVRERAWLTWEKVSSVDGVLESYIQKKKELWGICIFIAAVDLDEMPFTFTELQKN
IETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSSLIST
EINSMLVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPALLKEPYKTAV
IPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSL
GIVASNGLPEVENLSKQYEEIYFKNKDLDARLFLDHDKTLQADPTDSFEMQRTPQKSNPD
EELSVILQQTPVRTVMNTIQQLMMILNSASDQPSDNLISYFNNCTVNPKESILKRVKDIG
YIFKEKFAKAVGQGCIEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNTFH
MSLLACALEVVMATYSRSTSQNLDTGTDLSFPWILNVFNLKAFDFYKVIESFIKAEANLT
RDMIKHLERCEHRIMESLAWLSNSPLFDLIKQVKDREGPADHLESACTLNLSLQNNHTAA
DMYLSPVRSPKKKGSTTRVNSTANAEAQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLN
TLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKI
IVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIP
HIPRSPYKFSSSPLRIPGGNIYISPLKNPYKISEGLPTPTKMTPRSRILVSIGESFGTSE
KFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGPDEADGSKHLPGDSKFQQKLAE
MTSTRTRMQKQKMNESMNISNREEK
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgccgcccaaagccccccggagagtagccaccgcctccgccgccgcacccccggcaccg
ccgccgccaccccctactgaggaagaccccgaacaggacagtggccccgaggacctgcct
ctggccaggcttgagtttgaagaaactgaagaacctgattttactgcgttatgtcaaaaa
ttaaagataccagatcatgtcagagaaagagcttggttaacttgggagaaagtttcatct
gtggatggagtattggaaagttatattcaaaagaaaaaggaactgtggggtatctgtatc
tttattgcagcagttgacctagatgagatgccatttacttttactgagctacagaaaaac
atagaaaccagtgtctataaattctttgacttactaaaagaaattgataccagtaccaaa
gttgacaatgctatgtcaagactattgaagaagtacaatgtattgtgtgcactctacagc
aaattggaaaggacatgtgaacttatatatttgacacaaccaagcagtttgatatctact
gaaataaattctatgttggtgctaaaagtttcttggatcacatttttactagctaaaggg
gaagtattacaaatggaagatgatcttgtaatctcatttcagttaatgctgtgtgtcctt
gactattttatcaaactttcacctcctgcattactcaaagaaccatataaaacagctgta
atacctattaatggttcacctcgaacaccaaggcgaggtcagaacaggagtgcacggata
gcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaacatgaatgt
aatatagatgaggtgaaaaacgtttatttcaaaaattttataccttttatgaattctctt
ggaattgtagcttctaatggacttccagaggtggaaaatctctctaaacaatatgaagaa
atttattttaaaaataaagatctagatgcaagattatttctggatcatgataaaactctt
caggctgatcctacagacagttttgaaatgcagagaacaccacagaaaagtaaccctgat
gaagagttgagtgtgattcttcaacagactcctgttaggactgttatgaatactatccaa
caattaatgatgatcctaaattcagcaagtgatcaaccatcagataatctgatttcctat
tttaataactgcacggtaaatccaaaagaaagtatcctgaagagagtaaaggatattgga
tatatctttaaagagaaatttgctaaagctgtgggacagggatgcatagaaattgggtca
cagcgatacaaacttggagttcgattgtattaccgagtaatggaatctatgcttaaatca
gaagaagaacgattatccattcaaaattttagcaaactcctgaatgacaacacctttcat
atgtctttgttggcatgtgcccttgaagttgtaatggctacatatagcagaagtacatct
cagaatcttgatactggaacagatttgtccttcccatggattctgaatgtatttaattta
aaagcctttgatttttacaaagtgattgaaagttttatcaaagcagaagccaacttgacc
agagatatgataaaacatttagaacgatgtgaacatcgaattatggaatcccttgcatgg
ctctcaaattcacctttattcgatcttattaaacaagtgaaggaccgagaaggaccagct
gatcaccttgaatctgcttgtactctcaacctttctcttcagaataatcatactgcagca
gatatgtatctttctcctgtaagatccccaaagaaaaaagggtcaactacacgtgttaat
tctactgcaaatgcagaggcacaagcaacctcagccttccagactcagaagccattgaaa
tctacctccctttcactcttttacaaaaaagtgtaccgactagcatatcttcgactaaat
actctgtgtgcgcgccttctgtctgaccacccagagctagaacatatcatctggaccctt
ttccagcacacattgcaaaatgaatatgaactcatgagagacaggcatttggaccagatt
atgatgtgttccatgtatggcatatgcaaagtgaagaatatagaccttaaattcaaaatc
attgtaacagcttacaaggatcttcctcatgctgttcaggagacattcaaacgggttttg
atcagagaagaggagtatgattctattatagtattctataactcagtcttcatgcagaga
ctgaaaacaaatattttgcagtatgcttccaccaggccccctaccttgtcaccaatacct
cacattcctcgaagcccttacaagttttccagttcacctttacggattcccgggggaaac
atctatatatcacccctgaagaatccatataaaatttcagaaggtctgccaacgccaaca
aaaatgactccaagatcaagaatcttagtatcaattggtgaatcatttgggacttctgag
aagttccagaaaataaatcagatggtgtgtaacagtgaccgtgtcctcaaaagaagtgct
gaaggaagcaaccctcctaaaccactgaaaaaactacgctttgacattgagggacccgat
gaagcagatggaagtaaacatctcccaggagactccaaatttcaacagaaactggcagaa
atgacatctactcgaacaagaatgcaaaagcagaaaatgaatgaaagcatgaatatctca
aacagggaagaaaaatga

DBGET integrated database retrieval system