KEGG   Pteropus alecto (black flying fox): 102893203
Entry
102893203         CDS       T02993                                 

Gene name
PIAS4
Definition
(RefSeq) E3 SUMO-protein ligase PIAS4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04064  NF-kappa B signaling pathway
pale04120  Ubiquitin mediated proteolysis
pale04630  JAK-STAT signaling pathway
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102893203 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102893203 (PIAS4)
   04064 NF-kappa B signaling pathway
    102893203 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102893203 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102893203 (PIAS4)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102893203 (PIAS4)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   102893203 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP
Other DBs
NCBI-GeneID: 102893203
NCBI-ProteinID: XP_006904169
LinkDB
Position
Unknown
AA seq 514 aa
MAFGRNFRSSLGLHIQNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPE
LFKKIKELYETRYAKKSSEPVPQPHRPLDPLTMHSTYDRAGTVPRTPLTGPNIDYPVLYG
KYLNGLGRLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQV
ELIRNSRELQPGVKAVQVVLRICYSDTSSPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPG
VEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGV
KHPELCKALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFY
LQMNEKKPTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIGTEKER
SCSPQCPILVLGTSDTNGLASTPSVNGGGGGVLGGXXXXXXXXNGKPGTDVVDLTLDSSS
SSEEEEDEDEEDEDEDAPRPKRRCPFQKGLVSAC
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggccttcggacgtaacttcaggtcttccctgggtctgcatattcagaacatggtgatg
agtttccgagtctccgatcttcagatgctcctgggttttgtcggccggagtaagagtgga
cttaaacacgaactcgtcacccgggccctccagctggtccagtttgactgtagccccgag
ctgttcaagaagatcaaggagctctacgagacacgctacgccaagaagagctcggagccc
gtcccccagccccaccggcccctggaccccctgaccatgcactcgacctacgaccgggcc
ggcacggtgcccaggactccgctcacaggccccaacattgactaccccgtgctctatggg
aagtacttaaatggactcggacggctgcccgccaagaccctcaagccggaggtgcgcctg
gtgaagctgcccttcttcaacatgctggacgaactgctgaagcccaccgagctggttcca
cagaataatgagaagcttcaagagagcccgtgcatcttcgccttgacacccagacaggtg
gagctgatccggaactccagagaactgcagcctggggtcaaggctgtgcaggtcgtccta
agaatctgctactcagacaccagcagccctcaggaggaccagtacccacccaacatcgcc
gtgaaggtcaaccacagctactgctcggtcccgggctactacccctcgaacaagcccggc
gtggagcccaagaggccttgccgccccatcaacctcacccacctcatgtacctgtcctcg
gccaccaaccgcatcaccgtcacctgggggaactatggcaagagttattcggtggccttg
tacttggtgcggcagctgacgtcctcggagttgctgcagaggttgaaaaccatcggggtc
aagcacccggagctgtgcaaggcgctggtcaaagagaagctgcgcctggaccctgacagc
gagatcgccaccaccggcgtgcgggtctccctcatctgcccgctggtgaagatgcggctc
tcagtgccctgccgggcagagacctgtgcccacttgcagtgcttcgacgccgtcttctac
ctccagatgaacgagaagaagcccacctggatgtgccccgtgtgtgacaagccagccccc
tacgaccagctcatcatcgacgggctgctctccaagatcctgagcgagtgcgaggacgcg
gacgagatcgagtacctggtggacggctcgtggtgcccgatcggcacggagaaggagcgc
agctgcagcccccagtgccccatcctcgtgctcggcacctcggacaccaatggccttgcg
tccacccccagcgtcaacggaggtggcggtggcgtgcttgggggnnnnnnnnnnnnnnnn
nnnnnnnacaatgggaagcctggcaccgacgtggtggacctcacgctggacagctcctcg
tcctcggaggaagaggaggacgaggacgaggaggacgaggacgaggacgccccccggccc
aagcgccgctgccccttccagaagggcctggtgtccgcctgctga

KEGG   Pteropus alecto (black flying fox): 102893358
Entry
102893358         CDS       T02993                                 

Gene name
PIAS1
Definition
(RefSeq) E3 SUMO-protein ligase PIAS1 isoform X1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04120  Ubiquitin mediated proteolysis
pale04630  JAK-STAT signaling pathway
pale05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102893358 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102893358 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    102893358 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102893358 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pale04812]
    102893358 (PIAS1)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     102893358 (PIAS1)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   102893358 (PIAS1)
Cytoskeleton proteins [BR:pale04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    102893358 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 102893358
NCBI-ProteinID: XP_006920285
LinkDB
Position
Unknown
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSGPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVSASYNGVDGCLSSALEHQVTSQHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHGHTVTNRSSTDTASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactacaa
gtattgttgggctacgccgggagaaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggctgcagtcctgctgtacaaatgaaaattaaagaactc
tataggcggaggttcccccagaaaatcatgacgcccgcggacttatccatccccaacgta
cattcaggtcctatgccagcaactttgtctccatctaccattccacaactcacttatgat
ggtcaccctgcatcatcgccgttactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccattttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcatttgcattgacaccacaacaagtgcagcaa
atcagtagttcaatggatatttctgggaccaaatgtgacttcacagttcaggtccagtta
aggttttgtttatcagaaaccagctgtccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatacaaaaccttgcagccttccaggttatcttccacctactaaaaatggt
gtggaaccaaagcgacccagccgaccaattaatatcacctcacttgtccgattgtccaca
acagtaccaaacaccattgttgtttcttggactgcagaaattggaagaaactattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaagctgactgcagatcca
gacagcgaaatagctacaaccagcctaagggtttctctactatgtccacttggtaaaatg
cggctgacaattccatgtcgggcccttacatgttctcatctgcagtgttttgacgcaact
ctttatattcagatgaatgagaaaaaaccaacttgggtttgtcctgtttgtgataagaag
gctccatatgaacaccttattattgatggcttgtttatggaaatcctaaagtactgtaca
gattgcgatgaaatacagtttaaggaggatggctcttgggcacctatgagatcaaaaaag
gaagtacaggaagtttctgcctcttacaatggagttgatggatgcttgagctctgccttg
gagcatcaggtgacttctcaacaccagtcctcaaataaaaataaaaaagtagaggtgatt
gacctaaccatagacagttcatctgatgaagaggaggaagagccatctgccaagaggacc
tgtccttccctatctcccacatcaccactaaataataaaggcatattaagtcttccacat
caagcatctccagtgtcccgcaccccaagcctccctgctgtagacacaagctacattaac
acatccctcatccaagactacaggcatcctttccacatgacacccatgccttatgactta
caaggattagatttctttcctttcttatcaggagacaatcagcattacaacacctccctc
cttgctgctgcagcggcagcagtttcagatgatcaagacctcttacactcgtctcgattt
tttccgtatacctcctcacagatgtttcttgatcagttaagtgcaggaggcagtacttct
ctgccaaccaccaatggcagcagtagtggcagtaacagcagcctcgtgtcctccaacagc
ctaagggagagccatggccacaccgtcacaaacaggagcagcacggacacagcatccatc
ttcggcatcataccagacattatttcgttggactga

KEGG   Pteropus alecto (black flying fox): 102895265
Entry
102895265         CDS       T02993                                 

Gene name
PIAS2
Definition
(RefSeq) LOW QUALITY PROTEIN: E3 SUMO-protein ligase PIAS2
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04120  Ubiquitin mediated proteolysis
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102895265 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102895265 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102895265 (PIAS2)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     102895265 (PIAS2)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   102895265 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 102895265
NCBI-ProteinID: XP_024894484
LinkDB
Position
Unknown
AA seq 616 aa
MVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTL
EGLSDLSTIKSSVFNLDGSSSPVEPDLTVAGIHALPSTSVTPHSPSSPVGSVLLQDTKPT
FEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVR
EICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPK
NGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLK
MKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFD
AALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRP
KKEAMKVSSQPCTKIESSSVLSKPCSVTVANEASKKKVDVIDLTXXXXXXSSDXEDDPPA
KRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSS
DLPGLDFLSLIPVDPQQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSETG
VITSSGSNIPDIISLD
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggtttctagttttagggtttctgaactacaagtgttactaggctttgctgggcggaat
aaaagtggacgcaagcatgacctcctgatgagggcgttgcatttattgaagagcggctgc
agccctgcggttcagattaaaatccgagagttgtatagacgccgatacccacggactctt
gaaggactttctgatttatccacaatcaaatcatcggttttcaatttggatggtagctca
tcacctgtagaacctgacttgaccgtggctgggatccacgcgttgccttccacttcagtt
acacctcactcaccgtcctctcctgttggttctgtgttgcttcaagatactaagcccaca
tttgagatgcagcagccatctcctcccattcctcctgtccatcctgatgtgcagttaaaa
aacttgcccttttatgacgttcttgatgttctcatcaagcctacgagtttagttcaaagc
agtattcaacgatttcaagagaagttttttatttttgctctgacacctcagcaagttaga
gagatatgcatatccagggattttttgccaggtggtaggcgagattatacagtccaagtt
cagctgagactttgcctggcagagacaagttgccctcaagaagataactatcccaatagt
ctatgtataaaagtaaatgggaagctgtttcctttgcctggctatgcaccaccacctaaa
aatgggattgaacagaagcgccctggacgccctttgaatatcacatccttagttaggtta
tcttcagctgtgccaaaccagatttctatttcttgggcatcagaaattggaaagaattac
tccatgtctgtatatcttgtacgacagctcacgtcagccatgttattacagagattaaaa
atgaaaggtattagaaaccctgatcattccagagcactaattaaagaaaaacttactgca
gatcctgatagtgaaattgctacaactagccttcgggtatccttgatgtgcccattaggg
aaaatgaggctgacaatcccatgccgtgcagtgacttgtacacatctacagtgttttgat
gctgccctttatctgcaaatgaatgagaagaagcccacctggatttgtcctgtatgtgac
aaaaaagctgcctatgaaagtctaattttagatgggctttttatggaaattctcaatgac
tgttctgatgtggatgagatcaaattccaagaagatggctcttggtgtccaatgagaccg
aagaaagaagctatgaaagtatccagccaaccatgtacaaaaatagaaagttcaagtgtc
ctcagtaagccttgttcagtaactgtagccaacgaggcaagcaagaagaaagtggatgtt
attgacctaacaannnnnnnnnnnnnnnnntcttccgatnnggaggacgaccctcctgcc
aaaaggaagtgcatctttatgtcagaaacacaaagcagcccaaccaaaggggttctcatg
tatcagccatcttctgtaagggtgcccagtgtgacttcagttgatcctgctgctattcca
ccttcattaacagactactcagtaccattccaccacacgccgatatcaagcatgtcatca
gatttgccaggtttggattttctttcccttattccagttgatccccagcagtactgtcct
cctatgtttttggatagtctcacctcacccttaacagcaagcagtacgtctgtcaccacc
accagcccccatgaaagcagtactcatgttagttcatccagcagcaggagtgagacaggg
gtcataaccagcagtggaagtaacattcctgacatcatctcattggactaa

KEGG   Pteropus alecto (black flying fox): 102895609
Entry
102895609         CDS       T02993                                 

Gene name
PIAS3
Definition
(RefSeq) E3 SUMO-protein ligase PIAS3
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04120  Ubiquitin mediated proteolysis
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102895609 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102895609 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pale04121]
    102895609 (PIAS3)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     102895609 (PIAS3)
Ubiquitin system [BR:pale04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   102895609 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 102895609
NCBI-ProteinID: XP_006919766
LinkDB
Position
Unknown
AA seq 568 aa
MKERSKIFVPGRWSKQHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPS
VQMKIKELYRRRFPRKSLGPSDLSLLSLPPGTPPVGSPGPLAPIPPALLAPGTLLGPKRE
VDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQI
LTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNG
AEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAK
GIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAA
LYLQMNEKKPTWTCPVCDKKAPYDSLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKK
EASEVCPPPGYGLDGLQYSPVQEGNPSENKKKVEVIDLTIESSSDEEDLPPSKKHCPVTS
AAIPALPGSKGVLTSSHQPSSVLRSPAMGTLGGDFLSSLPLPEYPPAFPLGADIQGLDLF
SFLQTESQVSGPPLPLKISDLRSLFSGH
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgaaggagagaagcaagatattcgttcctggcaggtggagtaaacagcacatggtgatg
agtttccgggtgtctgagctccaggtgctcctcggctttgctggccggaacaagagtgga
cggaagcacgagctcctggccaaggccctgcaccttctcaagtccagctgtgcccccagc
gtccagatgaagatcaaggagctttaccgccgacgcttcccccggaagagcctggggccc
tcggacctctccctgctctcgctgccccctggcacccctcctgtaggctcccctggccct
ctggctcccatccccccggccctcttggcccctggcaccctgctgggccctaagcgtgaa
gtggacatgcacccccctctgccccagcctgtgcaccccgatgtcaccatgaaaccattg
cctttctatgaagtctacggggagctcatccggcccaccaccctcgcatccacctccagc
cagcggtttgaggaagcgcactttacctttgccctcacccctcagcaagtgcagcagatt
ctcacatccagagaggttctgccaggagccaaatgcgattataccatacaggtgcagcta
aggttctgtctctgtgagaccagctgcccccaagaggattatttcccccccaacctcttt
gtcaaggtcaatgggaaactgtgccccctgccgggctaccttccccccaccaagaacgga
gcggagcccaagaggcccagccgccccatcaacatcacacccctggctcgactctcggcc
acggttcccaacaccattgtggtcaactggtcttctgagtttggacggaattactccttg
tccgtgtacctggtgaggcagttgaccgcagggacccttctacagaaactcagagcaaag
ggcatccggaaccccgaccactcccgggcgctgatcaaggagaaattgaccgctgacccg
gacagtgaggtggccactacaagtctccgggtgtcactcatgtgcccgctagggaagatg
cgcctgactgtcccttgtcgcgccctcacctgcgcccacctgcagagcttcgatgctgct
ctgtatctacagatgaatgagaagaagccgacatggacatgtcctgtgtgcgacaagaag
gctccctatgactctcttatcattgatgggttattcatggagattcttaattcctgctcg
gattgtgatgagatccagttcatggaagatggatcctggtgcccaatgaaacccaagaag
gaggcatctgaggtttgccccccgccagggtatgggctggatggcctccagtatagccca
gtccaagagggcaatccttcagagaataaaaagaaggttgaagttattgacttgacaata
gaaagctcatcagacgaggaggacctgcccccaagcaagaagcactgtcctgtcacctca
gctgccatcccggccctacctggaagcaaaggggtactgacatccagtcaccagccatcc
tcggtgctacggagcccagctatgggcacactgggcggggatttcctgtccagtctccca
ctacccgagtacccacccgccttcccactgggggccgacatccaaggtttagatttattt
tcttttcttcagactgagagtcaggtaagtggtcctcctcttcccttgaagatctcagat
ctccgaagcctcttttctgggcactag

DBGET integrated database retrieval system