KEGG   Pteropus alecto (black flying fox): 102893397
Entry
102893397         CDS       T02993                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X1
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04114  Oocyte meiosis
pale04115  p53 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04218  Cellular senescence
pale04914  Progesterone-mediated oocyte maturation
pale04934  Cushing syndrome
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05215  Prostate cancer
pale05222  Small cell lung cancer
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102893397 (CDK2)
   04151 PI3K-Akt signaling pathway
    102893397 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102893397 (CDK2)
   04114 Oocyte meiosis
    102893397 (CDK2)
   04115 p53 signaling pathway
    102893397 (CDK2)
   04218 Cellular senescence
    102893397 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102893397 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893397 (CDK2)
   05203 Viral carcinogenesis
    102893397 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    102893397 (CDK2)
   05215 Prostate cancer
    102893397 (CDK2)
   05222 Small cell lung cancer
    102893397 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102893397 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102893397 (CDK2)
   05161 Hepatitis B
    102893397 (CDK2)
   05160 Hepatitis C
    102893397 (CDK2)
   05162 Measles
    102893397 (CDK2)
   05169 Epstein-Barr virus infection
    102893397 (CDK2)
   05165 Human papillomavirus infection
    102893397 (CDK2)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102893397 (CDK2)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102893397 (CDK2)
DNA replication proteins [BR:pale03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102893397 (CDK2)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102893397 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 102893397
NCBI-ProteinID: XP_006908934
UniProt: L5KWR5
LinkDB
Position
Unknown
AA seq 346 aa
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVS
TPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALTHPFFQDVTKPVPHLRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagaactttcaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaagctgactggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acagagggtgtacccagtactgccatacgagagatctctctacttaaggaacttaaccac
cctaatattgtcaagttgctggatgtcatccacacagaaaacaaactctacttggttttt
gagtttctgcaccaggatctcaagaaatttatggatgcctctgctcttactggtatccct
cttcccctcatcaagagctatctgttccagctgctccagggtctagctttctgccattct
caccgggtcctgcaccgagatctcaaacctcagaatctgcttatcaacgcagagggttcc
atcaagctagcagactttggactagccagagcctttggagtccctgttcgtacttacacc
catgaggtggtaaccctgtggtaccgagcacctgaaattcttctgggctgcaaatattac
tccacagctgtggacatctggagcctgggctgtatctttgctgagatgcacctagtgtgt
acccagcaccatgctaagtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcatcacaaggaggggggatgaccgcagtgtct
accccacaccccgtgacccgccgggccctattccctggagattctgagatcgaccaactc
ttccggatctttcggactctggggaccccagatgaggtcgtttggccaggagtcacttct
atgcctgattataaaccgagtttccccaagtgggcccggcaagattttagcaaagttgtg
cctcccctggatgaagatggaaggagcttgttatcgcaaatgctgcactacgaccccaac
aagcggatttcggcaaaggcagctctgactcaccctttcttccaggatgtgaccaagcca
gtaccccaccttcgactctga

DBGET integrated database retrieval system