KEGG   Pteropus alecto (black flying fox): 102893495
Entry
102893495         CDS       T02993                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04072  Phospholipase D signaling pathway
pale04144  Endocytosis
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale04520  Adherens junction
pale04540  Gap junction
pale04630  JAK-STAT signaling pathway
pale04810  Regulation of actin cytoskeleton
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04921  Oxytocin signaling pathway
pale04926  Relaxin signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale05160  Hepatitis C
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05219  Bladder cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102893495 (EGFR)
   04012 ErbB signaling pathway
    102893495 (EGFR)
   04014 Ras signaling pathway
    102893495 (EGFR)
   04015 Rap1 signaling pathway
    102893495 (EGFR)
   04630 JAK-STAT signaling pathway
    102893495 (EGFR)
   04066 HIF-1 signaling pathway
    102893495 (EGFR)
   04068 FoxO signaling pathway
    102893495 (EGFR)
   04020 Calcium signaling pathway
    102893495 (EGFR)
   04072 Phospholipase D signaling pathway
    102893495 (EGFR)
   04151 PI3K-Akt signaling pathway
    102893495 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102893495 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102893495 (EGFR)
   04520 Adherens junction
    102893495 (EGFR)
   04540 Gap junction
    102893495 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102893495 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102893495 (EGFR)
   04915 Estrogen signaling pathway
    102893495 (EGFR)
   04921 Oxytocin signaling pathway
    102893495 (EGFR)
   04926 Relaxin signaling pathway
    102893495 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    102893495 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893495 (EGFR)
   05206 MicroRNAs in cancer
    102893495 (EGFR)
   05205 Proteoglycans in cancer
    102893495 (EGFR)
   05230 Central carbon metabolism in cancer
    102893495 (EGFR)
   05231 Choline metabolism in cancer
    102893495 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102893495 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102893495 (EGFR)
   05212 Pancreatic cancer
    102893495 (EGFR)
   05225 Hepatocellular carcinoma
    102893495 (EGFR)
   05226 Gastric cancer
    102893495 (EGFR)
   05214 Glioma
    102893495 (EGFR)
   05218 Melanoma
    102893495 (EGFR)
   05219 Bladder cancer
    102893495 (EGFR)
   05215 Prostate cancer
    102893495 (EGFR)
   05213 Endometrial cancer
    102893495 (EGFR)
   05224 Breast cancer
    102893495 (EGFR)
   05223 Non-small cell lung cancer
    102893495 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102893495 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102893495 (EGFR)
   05171 Coronavirus disease - COVID-19
    102893495 (EGFR)
   05163 Human cytomegalovirus infection
    102893495 (EGFR)
   05165 Human papillomavirus infection
    102893495 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102893495 (EGFR)
   01522 Endocrine resistance
    102893495 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102893495 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pale04147]
    102893495 (EGFR)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102893495 (EGFR)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102893495 (EGFR)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102893495 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   102893495 (EGFR)
  Exosomal proteins of bladder cancer cells
   102893495 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase APH
Other DBs
NCBI-GeneID: 102893495
NCBI-ProteinID: XP_024902585
LinkDB
Position
Unknown
AA seq 1219 aa
MLNNCEVVLGNLEITYMQRNYDLSFLKTIQEVAGYVLIALNVAETIPLENLQIIRGNVLF
ENTHALSVLSNYGANKTGLRELPMRNLQEILQGAVRFNNNPLLCNVETIQWRDIVDSTFL
SNMSLDFQNQMSSCPKCDPSCPNGSCWGAGQENCQKLTRIVCAQQCSRRCRGRSPSDCCH
SQCAAGCTGPRESDCLVCHKFRDEATCKDTCPPLMLYNPTTYEMDVNPEGKYSFGATCVK
KCPRNYVVTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINA
TNIKHFKNCTSISGDLHILPVAFKGDSFTHTPPLDPKELDILKTVKEITGFLLIQAWPEN
RTDLHAFENLEIIRGRTKQHGQFSLAVVGLHITSLGLRSLKEISDGDVVISGNQKLCYAD
TIRWQNLFGTFSQKTKIINNRNGRDCQAAGHVCNPLCSSEGCWGPEPKDCVSCRNVSRDR
ECVERCNLLEGEPREFVENSECVQCHPECLPQAMNVTCTGRGPDKCVKCAHYIDGPHCVK
TCPSGIMGENNTLVWKFSDANHVCHLCHRNCTYGCAGPGLEGCTYGPRIPSIATGIVGGL
LLVVVLALGVVLFLRRRYIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRVLKETEFKK
IKVLGSGAFGTVYKGLWNPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV
CRLLGICLTSTVQLVTQLMPFGCLLDYVREHKDNMLPRMRKVMYRTKTFVGCSAGAKRHP
GVYGPRDRRRVASSFSAKSLGLRMGFCHPSSWLPSASPCSPGGQLASVPSPHVPAFQGMN
YLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESI
LHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEVSALLEKGERLPQPPICTIDVYMI
MVKCWMIDAESRPKFRELVLEFCKMARDPQRFLVIQGDERMDLPSPTDSNFYRALMEEED
MEDVVDADEYLIPQHGFFHSPSTSRTPLLSSLSATSNTSAVACIDRNGQSCPLKEDSFLQ
RYSSDPTGALTEENINDTFLPVPEYMNQSIPKRPAGSVQNPVYHSQPLSPAAGREPHYQH
PHSSAVGNPEYLNTIRPASGDGPALWVQKGGHHISLDNPDYQQDFLPKEATSNGTFKGPA
AENAEYLRVAPASREFTGA
NT seq 3660 nt   +upstreamnt  +downstreamnt
atgctgaacaactgtgaggtggtccttgggaacctggaaattacctatatgcaaaggaat
tacgacctttccttcttaaagaccatccaggaggtggccggctacgtcctcatcgccctc
aacgtggcggagacgatcccgctggaaaacctgcagatcatcagagggaacgtgctcttc
gaaaacacgcacgccttgtcggtcctgtccaactacggggcaaacaaaacggggctgcgg
gagctccccatgagaaacctgcaggaaatcctgcaaggcgccgtgcgattcaacaacaac
cccctcctctgcaatgtggagaccatccagtggcgggacatcgtggacagcactttcctg
agcaacatgtcgctggactttcagaaccagatgagcagctgcccaaagtgcgacccaagc
tgtcccaacgggagctgctggggtgcgggacaggagaattgccagaaactgaccaggatc
gtgtgtgcccagcagtgctccaggcgctgccgtggcaggtcgcccagcgactgctgccac
agccagtgtgcggccggctgcaccgggccgcgggagagcgactgcctggtctgtcacaag
ttccgggacgaagccacgtgcaaggacacctgcccgccgctcatgctgtacaaccccacc
acgtacgagatggacgtcaacccggagggcaaatacagcttcggcgccacctgcgtgaag
aaatgtccccgtaactatgtggtgacagaccacggctcgtgcgtccgcgcctgcagctct
gacagctacgaggtggaggaggacggggttcgcaagtgtaagaagtgcgaagggccttgt
cgcaaagtttgcaacggaataggaattggtgaatttaaagacacactttccataaatgct
acgaatatcaaacacttcaaaaactgcacctccatcagtggggacctccacatcctgccg
gtagctttcaagggtgactctttcactcacaccccgcctctggacccgaaggaactggac
attctgaaaaccgtgaaggagataacagggtttttgctgattcaggcctggccagaaaac
aggactgacctccatgctttcgagaacctggaaatcatacgtggcagaacaaagcaacat
ggccagttttctctcgcggtcgtcggcctgcacatcacgtcgctgggactacgctccctc
aaggagataagtgacggagacgtggtcatctcggggaaccagaagttgtgctacgcagac
accatacgctggcaaaacctatttgggaccttcagccagaaaaccaagattataaacaat
aggaatggacgagactgccaggccgcgggccatgtctgtaacccactctgctcgtcagag
ggctgctggggcccggagccaaaggactgtgtgtcctgcaggaacgtcagccgtgaccgg
gagtgcgtggagaggtgcaacctcctggagggcgagcccagggagtttgtggagaactct
gagtgcgtgcagtgccatccagaatgcctgccccaggccatgaacgtaacctgcacggga
cgcggaccagacaagtgtgtaaagtgtgcccactacatcgatggcccccactgtgtcaag
acctgcccgtctgggatcatgggagaaaacaacacgctggtctggaagttctcagatgcc
aatcacgtgtgtcacctgtgccaccgaaactgtacatacggctgcgctgggccgggtctc
gaaggctgcacgtatgggcccaggatcccgtccatcgccaccggcatcgtgggcggcctg
ctgctggtggtggtgctggccctcggggtcgtcctcttcctgcgcaggcgttacatcgtc
cggaagcgcacgctgcgccggctgctgcaggagagagagctcgtggagcccctcacgccc
agtggggaggcccccaaccaggctctcctgagggtcttgaaggagacggagttcaaaaag
atcaaggtgctgggctctggcgcattcggcacggtgtacaagggtctctggaacccagaa
ggcgagaaggtcaagatccccgtggctatcaaggagttgcgagaagccacgtctccaaaa
gccaacaaggaaattcttgatgaagcctacgtgatggccagcgtggacaaccctcacgtg
tgccgcctgctgggcatctgcctgacctccacagtccagctggtcacgcagctcatgccc
ttcggctgcctcctggactatgtccgtgagcacaaggacaacatgctcccaaggatgcgg
aaggtgatgtacaggacaaagacgtttgtgggctgctcggctggagcaaagcgccatcct
ggcgtttatgggccacgcgaccgcagacgagtggcctcgtctttcagcgccaagtctctg
gggctgcgcatgggcttctgccacccgtcttcctggctcccctcagccagtccatgctct
cccgggggccagctggcgtccgtgccctcaccccatgttcccgcgtttcagggcatgaac
tacctggaagaccggcgtttggtgcatcgtgacctggccgccaggaacgtcctggtgaag
acgccacagcacgtcaagatcacagacttcgggctggccaagctgctgggcgccgaggag
aaggaataccacgcggagggaggcaaggtgcctatcaagtggatggctttggaatcgatt
ttacaccgaatttatacccaccaaagtgacgtctggagctatggtgtcaccgtgtgggag
ctgatgacgttcgggtccaagccttatgatggcatcccggcgagcgaggtctcggccctg
ctggagaagggagagcgcctcccgcagccgcccatatgcaccatcgacgtctacatgatc
atggtcaagtgctggatgatagatgcagagagtcgccccaagttccgtgagttggtcctc
gaattctgcaaaatggcccgagacccccagcgcttccttgtcatccagggggacgagaga
atggacttgcccagccccacggactccaacttctaccgcgccctcatggaagaggaggac
atggaggacgtggtggacgcggacgagtacctgatcccgcagcacggcttcttccacagc
ccctccacgtcccgcacgcccctcctgagctccctgagtgccaccagcaacacttccgcc
gtggcttgcatcgacagaaacgggcagagctgtcccctcaaggaagacagcttcttacag
cgctacagctcagaccccaccggcgccttgaccgaggagaacatcaacgacactttcctc
ccagtgcccgaatacatgaaccagtccatccccaaaaggcccgcgggctctgtgcagaac
ccggtgtaccacagtcagcccctgagccccgccgccggcagagagccgcactaccagcac
ccccacagcagcgccgtgggcaaccccgagtatctcaacaccatccgccccgccagcggc
gacggccctgccctctgggtgcagaaaggaggccaccacattagcctggacaaccctgac
taccagcaggacttcctgcccaaggaagccacgtcgaacggcacgttcaagggcccggcc
gccgaaaacgcagagtacctgcgggtagccccggcgagccgcgagttcaccggcgcgtga

DBGET integrated database retrieval system