KEGG   Pteropus alecto (black flying fox): 102893728
Entry
102893728         CDS       T02993                                 

Gene name
MSH2
Definition
(RefSeq) DNA mismatch repair protein Msh2 isoform X3
  KO
K08735  DNA mismatch repair protein MSH2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale03430  Mismatch repair
pale05200  Pathways in cancer
pale05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    102893728 (MSH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893728 (MSH2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102893728 (MSH2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102893728 (MSH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pale03400]
    102893728 (MSH2)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     102893728 (MSH2)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_IV MutS_I AAA_27
Other DBs
NCBI-GeneID: 102893728
NCBI-ProteinID: XP_006909676
LinkDB
Position
Unknown
AA seq 934 aa
MAVQPKETLQLESAAEFGFVRFFQGMPEKPTTTVRLFDRGDFYTAHREDALLAAREVFKT
QGVVKYIGPAGAKTLESVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKAFKENDWYLA
FKASPGNLSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVDSIQKKLGLCEFPD
NDQFSNLEALLIQIGPKECVLPAGETTGDMGKLRQVIQRGGILITERKRADFSTKDVYQD
LNRLLKGKKGEQVNSVVLPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELTTFDFSQYM
KLDIAAVRACNLFQGSVEDTSGSQSLTALLNKCKTPQGQRLVNQWIKQPLMDKSRIEERL
NLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPSVISA
LGKYEGKHQTLLLAVFVTPFVDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSE
LREIMDDLEKKMQSTLISTARDLGLDSGKQIKLDSNSQFGYYFRVTCKEEKVLRNNKNFS
TVDIQKNGVKFTNSTLTSLNEEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLA
QLDAVVSFAHVSNGAPIPYVRPVILEKGQGRIKLKASRHACVEVQDEVAFIPNDVHFEKD
KQMFHIIIGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLK
GVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMF
ATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPRHV
IECAKQKALELEEFQNIGESQENDEMEPAAKRCYLEREQGEKIIQEFLCKVKQMPFTEMS
EENITIKLKQLKAEVIAKNNRFVNEIISRIKVTT
NT seq 2805 nt   +upstreamnt  +downstreamnt
atggcggtgcagccgaaggagacgctgcagctggagagcgcggcagagtttggctttgtg
cgcttctttcagggaatgccggagaagccgaccactacggtgcgcctcttcgaccggggc
gacttctacacggcgcaccgtgaggacgcgctgctggccgcccgggaggtgttcaagacc
cagggggtagtcaagtacattgggccggcaggagcaaagactctagagagtgttgtgctt
agtaaaatgaattttgagtcttttgtaaaagatcttcttctagttcgtcagtatagagtt
gaagtttataagaatagagctggaaataaggccttcaaggagaatgattggtatttggca
tttaaggcttctccaggtaatctttctcagtttgaagacattctctttggtaataatgat
atgtcagcttccattggtgttgtgggtgtaaaaatgtcaacagttgatggtcaaagacag
gttggagttgggtatgttgactccatacagaagaagctaggactatgtgagttccctgat
aatgatcagttctccaatctggaggctcttctgattcagattggaccaaaggaatgtgtt
ttaccagcgggagagactactggagacatgggaaaactgaggcaggttattcagagagga
ggaattcttatcacagaaagaaaaagagctgacttttccacaaaagatgtttatcaggac
ctcaaccggttgttgaaaggcaaaaaaggagaacaggtgaatagtgttgtcttgccggaa
atggagaatcaggttgcagtttcatcattgtctgcagtaatcaagtttttagaactctta
tcagatgattcaaactttggacagtttgaattgactacttttgacttcagccagtacatg
aaattggatattgcagcagtcagagcctgtaaccttttccagggttctgttgaagatacc
agtggatctcagtctctgactgcattgctgaataaatgcaaaacccctcagggacaaaga
ctggttaaccagtggattaagcagcctctcatggataagagcagaatagaagagagactg
aatttagtggaagcttttgtagaagatgcagaattgaggcagactttacaagaagattta
ctgcgtcgattcccagatcttaaccgacttgccaagaaatttcaaagacaagcagcaaac
ttacaagattgttaccgactatatcagggcataaaccaactccctagtgttataagtgct
ctgggaaaatacgaaggaaaacatcagacattgttgttggcagtttttgtgactcctttt
gttgatcttcgttctgatttctccaagtttcaggaaatgatagaaacaactttagatatg
gatcaggtggaaaaccatgaattccttgtaaaaccttcatttgatcctaatctgagtgaa
ttaagagaaataatggatgatttagaaaagaagatgcaatcaacattaataagtacagca
agagatctaggcttggattctggcaaacagattaaattggattccaactcacagtttgga
tattactttcgtgtaacgtgtaaggaagaaaaagtccttcgtaacaataaaaacttcagt
acagttgatattcagaagaatggtgttaaatttaccaatagtacattaacttctctcaat
gaagagtataccaaaaataaaactgagtacgaggaagcccaggatgccattgttaaagaa
attgtcaatatttcttcaggctatgtagaaccaatgcagacactcaatgatgtgttagct
cagctagatgctgtcgtcagctttgcccatgtgtcaaatggagcacctattccatatgta
cgaccggtcattttggagaaagggcaaggaagaattaagttgaaagcatccagacatgct
tgtgttgaagttcaagatgaagttgcatttattcctaatgatgttcactttgaaaaagat
aaacagatgttccacatcattataggccccaatatgggaggtaaatcaacatatattcgc
caaactggggtgatagttctcatggcccaaattgggtgttttgtgccgtgtgagtcagca
gaagtgtccattgtggactgtatcttggcccgggtaggggctggtgacagtcaattgaaa
ggagtctccacctttatggctgaaatgttagaaactgcttctattctcagatctgcgact
aaagattctttaataatcattgacgaattgggaagaggaacctctacctatgatggattc
gggttggcatgggctatatcagagtacattgcaacaaaaatcggtgctttttgcatgttt
gcaactcattttcatgaacttactgccttggcaaatcagataccaactgttaataatcta
catgtcacagcactaactacagaagagaccttaactatgctttatcaggtgaagaaaggt
gtctgtgatcagagttttgggattcacgttgcagagcttgctaatttccctaggcatgta
atagagtgtgctaaacaaaaagccctggaactagaagagtttcagaatattggagagtca
caagaaaatgatgaaatggaaccagcagcaaagaggtgctatctggaaagagagcaaggt
gagaaaattattcaagaatttttatgcaaggtgaagcaaatgcccttcactgaaatgtca
gaagaaaacatcacaataaagttaaaacagctgaaagctgaggtgatagcaaagaataat
aggtttgtaaatgaaatcatttcacgaataaaggttactacgtga

DBGET integrated database retrieval system