KEGG   Pteropus alecto (black flying fox): 102893928
Entry
102893928         CDS       T02993                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04144  Endocytosis
pale04218  Cellular senescence
pale04350  TGF-beta signaling pathway
pale04371  Apelin signaling pathway
pale04390  Hippo signaling pathway
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04659  Th17 cell differentiation
pale04926  Relaxin signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05142  Chagas disease
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05205  Proteoglycans in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102893928 (SMAD2)
   04390 Hippo signaling pathway
    102893928 (SMAD2)
   04371 Apelin signaling pathway
    102893928 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102893928 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    102893928 (SMAD2)
   04218 Cellular senescence
    102893928 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102893928 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102893928 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102893928 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102893928 (SMAD2)
   05205 Proteoglycans in cancer
    102893928 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102893928 (SMAD2)
   05212 Pancreatic cancer
    102893928 (SMAD2)
   05225 Hepatocellular carcinoma
    102893928 (SMAD2)
   05226 Gastric cancer
    102893928 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102893928 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102893928 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102893928 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102893928 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102893928
NCBI-ProteinID: XP_006919983
LinkDB
Position
Unknown
AA seq 461 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLLYLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPS
NSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRY
GWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEY
RRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccagttgtgaagagactgctgggatggaagaaa
tcagccggtggatctggaggagcaggcggaggagaacagaatggacaggaagaaaagtgg
tgtgagaaggcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaagtgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgacttcaggtatctcatcga
aaaggactgccacatgttatatattgccgattatggcgctggcctgatcttcacagtcat
cacgaactcaaagcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttttgcctccagtattagtg
ccacggcacactgagatcttaacagaactaccgcctctggatgattatacccactccatt
ccagaaaacactaatttcccagcgggaattgagccacagagtaattacatcccagaaacg
ccacctcctggatatatcagtgaagatggagaaacaagtgatcaacagttgaaccaaagt
atggatacaggatctccagcagaactatctcctactactctactctatttgcagccagtt
acttattcagaacctgcattttggtgttcaatagcatattatgaattaaaccagagggtt
ggagagaccttccatgcatcacagccctcactcactgtagacggcttcacagatccatca
aattcagagagattctgcttaggtttactctccaatgtcaaccgaaatgctacagtagaa
atgacaagaagacatataggaagaggcgtgcgcttatattacataggtggggaagttttt
gctgagtgcctaagtgatagtgcaatctttgtgcagagccccaattgtaatcagagatac
ggctggcaccctgcaacagtgtgtaaaattccaccaggctgtaatctgaagatcttcaac
aaccaagaatttgctgctcttctggctcagtctgttaatcagggttttgaagccgtgtat
caactaactagaatgtgcaccataagaatgagttttgtgaaagggtggggagcagaatac
cgaaggcagacggtaacgagcactccttgctggattgaacttcatctgaatggacctcta
cagtggttggacaaagtattaactcagatgggatccccttcagtgcgttgctcaagcatg
tcataa

KEGG   Pteropus alecto (black flying fox): 102895268
Entry
102895268         CDS       T02993                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04144  Endocytosis
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04350  TGF-beta signaling pathway
pale04371  Apelin signaling pathway
pale04390  Hippo signaling pathway
pale04520  Adherens junction
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04659  Th17 cell differentiation
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05161  Hepatitis B
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05212  Pancreatic cancer
pale05220  Chronic myeloid leukemia
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102895268 (SMAD3)
   04350 TGF-beta signaling pathway
    102895268 (SMAD3)
   04390 Hippo signaling pathway
    102895268 (SMAD3)
   04371 Apelin signaling pathway
    102895268 (SMAD3)
   04068 FoxO signaling pathway
    102895268 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102895268 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    102895268 (SMAD3)
   04218 Cellular senescence
    102895268 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102895268 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102895268 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102895268 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102895268 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102895268 (SMAD3)
   05212 Pancreatic cancer
    102895268 (SMAD3)
   05225 Hepatocellular carcinoma
    102895268 (SMAD3)
   05226 Gastric cancer
    102895268 (SMAD3)
   05220 Chronic myeloid leukemia
    102895268 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102895268 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102895268 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102895268 (SMAD3)
   05161 Hepatitis B
    102895268 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102895268
NCBI-ProteinID: XP_006920292
LinkDB
Position
Unknown
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHSNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgccctttactcctccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagacggggcagctggatgagctggagaaggccatcaccacgcagaatgtc
aacaccaagtgcatcactatcccaaggtccctggatggccgactgcaggtgtcccatagg
aaggggctcccccacgtcatctactgccgcttgtggcggtggcctgacctgcacagccac
catgagctgcgggctatggagctgtgtgagttcgccttcaacatgaagaaggacgaggtc
tgcgtgaatccctaccactatcagagggtagagaccccagttctacctcctgtgttggtg
ccgcgccacacggagatcccggccgagttccccccactggacgactacagccattccatc
cccgagaacactaacttccctgcgggcattgagcctcagagcaatattccagaaacccca
ccccctggctacctgagtgaagatggagagaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacacagtaacttagac
ctgcagcccgtcacctactgcgagccagccttctggtgctccatctcctactacgagctg
aaccagcgcgttggggagacattccacgcctcacagccctccatgacagtggacggcttc
accgacccctccaactcggagcgcttctgcctggggctactctccaatgtcaacaggaat
gcggctgtggaactcacgcggaggcatatcgggcgaggcgtgcggctgtactacatcgga
ggggaggtcttcgcagagtgcctcagcgacagcgctatcttcgtgcagtcccccaactgt
aaccagcgctatggttggcacccggccaccgtctgcaagatcccacctggatgcaacctg
aagatcttcaacaaccaggagttcgccgccctcctggctcagtctgtcaaccaaggtttc
gaggccgtctaccagctgacgcgcatgtgcaccatccgcatgagcttcgtcaaaggctgg
ggcgcagagtacaggagacagacagtgaccagcaccccctgctggatcgagctgcacctg
aatgggcctttgcaatggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcctag

DBGET integrated database retrieval system