KEGG   Pteropus alecto (black flying fox): 102894049
Entry
102894049         CDS       T02993                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04012  ErbB signaling pathway
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04218  Cellular senescence
pale04630  JAK-STAT signaling pathway
pale04921  Oxytocin signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05203  Viral carcinogenesis
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05212  Pancreatic cancer
pale05213  Endometrial cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05216  Thyroid cancer
pale05217  Basal cell carcinoma
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102894049 (CDKN1A)
   04630 JAK-STAT signaling pathway
    102894049 (CDKN1A)
   04066 HIF-1 signaling pathway
    102894049 (CDKN1A)
   04068 FoxO signaling pathway
    102894049 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    102894049 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102894049 (CDKN1A)
   04115 p53 signaling pathway
    102894049 (CDKN1A)
   04218 Cellular senescence
    102894049 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102894049 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    102894049 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102894049 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    102894049 (CDKN1A)
   05206 MicroRNAs in cancer
    102894049 (CDKN1A)
   05205 Proteoglycans in cancer
    102894049 (CDKN1A)
   05203 Viral carcinogenesis
    102894049 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102894049 (CDKN1A)
   05212 Pancreatic cancer
    102894049 (CDKN1A)
   05225 Hepatocellular carcinoma
    102894049 (CDKN1A)
   05226 Gastric cancer
    102894049 (CDKN1A)
   05214 Glioma
    102894049 (CDKN1A)
   05216 Thyroid cancer
    102894049 (CDKN1A)
   05220 Chronic myeloid leukemia
    102894049 (CDKN1A)
   05217 Basal cell carcinoma
    102894049 (CDKN1A)
   05218 Melanoma
    102894049 (CDKN1A)
   05211 Renal cell carcinoma
    102894049 (CDKN1A)
   05219 Bladder cancer
    102894049 (CDKN1A)
   05215 Prostate cancer
    102894049 (CDKN1A)
   05213 Endometrial cancer
    102894049 (CDKN1A)
   05224 Breast cancer
    102894049 (CDKN1A)
   05222 Small cell lung cancer
    102894049 (CDKN1A)
   05223 Non-small cell lung cancer
    102894049 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102894049 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102894049 (CDKN1A)
   05161 Hepatitis B
    102894049 (CDKN1A)
   05160 Hepatitis C
    102894049 (CDKN1A)
   05163 Human cytomegalovirus infection
    102894049 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102894049 (CDKN1A)
   05169 Epstein-Barr virus infection
    102894049 (CDKN1A)
   05165 Human papillomavirus infection
    102894049 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102894049 (CDKN1A)
   01522 Endocrine resistance
    102894049 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102894049
NCBI-ProteinID: XP_006907381
LinkDB
Position
Unknown
AA seq 164 aa
MSEPSRNARPIPQGSKACRRLFGPVDSEQLRRDCDALMASCVQEACERWNFDFVTETPLE
GNFAWERVWGLGLPKVYLPSGPRGTRDDVGGGRRPSSSPVLLQGTAQEDHVDLSLSCTLL
PRSPEQPEGSPGGPGISQGRKRRQTSMTDFYHSKRRLIFSKKKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccatcccgaaatgcccgtccaatcccccagggcagcaaggcctgtcgtcgc
ctcttcggcccagtggacagtgagcagctgcgccgagactgcgatgcactaatggccagc
tgtgtgcaggaggcctgtgagcgatggaacttcgactttgtcactgagacaccgctggag
ggcaactttgcctgggagcgtgtgtggggtctgggcctgcccaaggtctacttgccctcg
gggccccgggggacccgagacgacgtgggaggaggcaggcggcctagcagctcacctgtc
ctgctgcaggggacagctcaggaggaccatgtggacctgtcactgtcctgtaccctcttg
cctcgctcccctgagcagcctgaggggtccccaggtgggcctggtatctctcagggccgg
aaacggcggcagaccagcatgacagatttctatcactccaaacgccgcctgatcttctcc
aagaagaagccctaa

DBGET integrated database retrieval system