KEGG   Pteropus alecto (black flying fox): 102894192
Entry
102894192         CDS       T02993                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04390  Hippo signaling pathway
pale04810  Regulation of actin cytoskeleton
pale05200  Pathways in cancer
pale05218  Melanoma
pale05224  Breast cancer
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102894192 (FGF1)
   04014 Ras signaling pathway
    102894192 (FGF1)
   04015 Rap1 signaling pathway
    102894192 (FGF1)
   04390 Hippo signaling pathway
    102894192 (FGF1)
   04151 PI3K-Akt signaling pathway
    102894192 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102894192 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102894192 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102894192 (FGF1)
   05218 Melanoma
    102894192 (FGF1)
   05224 Breast cancer
    102894192 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102894192 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102894192 (FGF1)
Cytokines and growth factors [BR:pale04052]
 Growth factors
  Growth factors (RTK binding)
   102894192 (FGF1)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102894192 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102894192
NCBI-ProteinID: XP_006923043
UniProt: L5JWV5
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEVTTFTALTERFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDKSDQHIQLQ
LSAESVGEVYIKSTESGQYLAMDSDGLLYGSQTPDEDCLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgagggggaagtcacgacgttcacggccctgactgagaggtttaacctgcctcca
gggaattacaagaagcctaaacttctctactgcagcaacgggggccacttcctgaggatc
ctcccagatggcacagtggatgggacaagggacaagagcgaccagcacattcagctgcag
ctcagtgcggaaagtgtgggggaggtgtatataaagagcaccgagagtggccagtacttg
gccatggactccgacgggcttttgtacggctcacagacaccagatgaggactgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcagagaag
aattggtttgttgggctcaagaagaatggaagctgcaagcgcggtccccggactcactac
ggccagaaagcgatcctgtttctccccctgccagtctcctctgattag

DBGET integrated database retrieval system