KEGG   Pteropus alecto (black flying fox): 102894222
Entry
102894222         CDS       T02993                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04218  Cellular senescence
pale04530  Tight junction
pale04660  T cell receptor signaling pathway
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale04934  Cushing syndrome
pale05160  Hepatitis C
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05212  Pancreatic cancer
pale05214  Glioma
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102894222 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102894222 (CDK4)
   04115 p53 signaling pathway
    102894222 (CDK4)
   04218 Cellular senescence
    102894222 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102894222 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102894222 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102894222 (CDK4)
   05203 Viral carcinogenesis
    102894222 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102894222 (CDK4)
   05225 Hepatocellular carcinoma
    102894222 (CDK4)
   05214 Glioma
    102894222 (CDK4)
   05220 Chronic myeloid leukemia
    102894222 (CDK4)
   05218 Melanoma
    102894222 (CDK4)
   05219 Bladder cancer
    102894222 (CDK4)
   05224 Breast cancer
    102894222 (CDK4)
   05222 Small cell lung cancer
    102894222 (CDK4)
   05223 Non-small cell lung cancer
    102894222 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102894222 (CDK4)
   04934 Cushing syndrome
    102894222 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102894222 (CDK4)
   05160 Hepatitis C
    102894222 (CDK4)
   05164 Influenza A
    102894222 (CDK4)
   05162 Measles
    102894222 (CDK4)
   05163 Human cytomegalovirus infection
    102894222 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102894222 (CDK4)
   05169 Epstein-Barr virus infection
    102894222 (CDK4)
   05165 Human papillomavirus infection
    102894222 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102894222 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102894222 (CDK4)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102894222 (CDK4)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102894222 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 102894222
NCBI-ProteinID: XP_006909031
UniProt: L5KV52
LinkDB
Position
Unknown
AA seq 302 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAGGGLPISTVREVALLR
RLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDLM
RQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYR
APEVLLQSTYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRD
VSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHPYLQKAEGN
PE
NT seq 909 nt   +upstreamnt  +downstreamnt
atggctacccctcgatatgagccagtggctgagattggtgttggtgcgtatggaacggtg
tacaaggcccgtgatccccacagtggccactttgtcgccctcaagagcgtgagagttccc
aatggaggtgctggagggggccttcccatcagcacagttcgtgaggttgctttactgagg
cggctggaggcttttgagcatcccaatgttgtccggctgatggatgtctgtgccacagcc
cgaactgaccgggaaaccaaagtgaccctggtgtttgagcatgtggaccaagacctaagg
acgtatctggataaggcacccccaccaggcttgccagtggagaccatcaaggatctgatg
cgccagtttctaagaggcctagatttccttcatgccaactgcattgttcaccgggaccta
aagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggcctg
gccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtaccgt
gctccagaagttcttctgcagtctacgtatgcaacacctgtggacttgtggagtgttggc
tgtatcttcgctgagatgtttcgtcgaaagcctctcttctgcggaaattctgaagctgac
cagttaggcaaaatctttgacttgattgggctgcccccagaggatgactggccccgagat
gtctctctaccccggggagccttttcccccagagggccccgtccagtgcagtcggtggta
cctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaacccacac
aagcgaatctctgccttccgagccctgcagcatccttatctacaaaaggcagaaggtaac
ccagagtga

KEGG   Pteropus alecto (black flying fox): 102896272
Entry
102896272         CDS       T02993                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04218  Cellular senescence
pale04934  Cushing syndrome
pale05160  Hepatitis C
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05165  Human papillomavirus infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05206  MicroRNAs in cancer
pale05212  Pancreatic cancer
pale05214  Glioma
pale05218  Melanoma
pale05220  Chronic myeloid leukemia
pale05222  Small cell lung cancer
pale05223  Non-small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102896272 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102896272 (CDK6)
   04115 p53 signaling pathway
    102896272 (CDK6)
   04218 Cellular senescence
    102896272 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102896272 (CDK6)
   05206 MicroRNAs in cancer
    102896272 (CDK6)
   05203 Viral carcinogenesis
    102896272 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102896272 (CDK6)
   05225 Hepatocellular carcinoma
    102896272 (CDK6)
   05214 Glioma
    102896272 (CDK6)
   05220 Chronic myeloid leukemia
    102896272 (CDK6)
   05218 Melanoma
    102896272 (CDK6)
   05224 Breast cancer
    102896272 (CDK6)
   05222 Small cell lung cancer
    102896272 (CDK6)
   05223 Non-small cell lung cancer
    102896272 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102896272 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102896272 (CDK6)
   05164 Influenza A
    102896272 (CDK6)
   05162 Measles
    102896272 (CDK6)
   05163 Human cytomegalovirus infection
    102896272 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102896272 (CDK6)
   05169 Epstein-Barr virus infection
    102896272 (CDK6)
   05165 Human papillomavirus infection
    102896272 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102896272 (CDK6)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102896272 (CDK6)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102896272 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 102896272
NCBI-ProteinID: XP_006911958
LinkDB
Position
Unknown
AA seq 326 aa
MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKTPQPIEKFVADIDEQGKDLLLKCLTFNPAKRISAYSALSHPYF
HDLERCKENLDSHLPPSQNSSEMNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacagcctgagccgcgcggaccagcagtacgagtgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgggacctgaagaacggaggccgtttcgtg
gcgctgaagcgcgtgcgggtgcagacgggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagactttcgagcaccccaacgtggtcaggttattc
gatgtgtgtacagtgtcacgaacagacagagaaaccaaactaacattagtgtttgaacat
gttgatcaagacttgaccacttatttggataaagtcccagagcctggagtgcccactgaa
accataaaggacatgatgtttcagcttctccgaggtctggactttcttcattctcaccga
gtcgtgcatcgtgatctaaaaccacagaacattctcgtgaccagcagtggacaaataaaa
ctggctgacttcggccttgcccgcatctacagttttcagatggctctaacctcagtggtc
gtcacgctgtggtaccgagctccagaagttttgcttcagtccagctacgccacccccgtg
gacctctggagcgttggctgcatatttgcagaaatgtttcgtagaaagcctcttttccgt
ggcagttcagatgtcgatcaactaggaaaaatcttggatgtaatcggactcccaggagag
gaggactggcctagagatgttgcccttcccaggcaggcttttcactcaaaaactcctcaa
cctattgagaagtttgtagcagatattgatgaacaaggcaaagacctacttctgaagtgc
ttgacatttaatccagccaaaagaatatctgcctacagtgccctgtctcacccatacttc
cacgacctggagaggtgcaaggagaacctggattcccatctgccacccagccagaacagc
tcggagatgaatacagcctga

DBGET integrated database retrieval system