KEGG   Pteropus alecto (black flying fox): 102894298
Entry
102894298         CDS       T02993                                 

Gene name
ABCC2
Definition
(RefSeq) canalicular multispecific organic anion transporter 1
  KO
K05666  ATP-binding cassette, subfamily C (CFTR/MRP), member 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01523  Antifolate resistance
pale01524  Platinum drug resistance
pale02010  ABC transporters
pale04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    102894298 (ABCC2)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102894298 (ABCC2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102894298 (ABCC2)
   01523 Antifolate resistance
    102894298 (ABCC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pale02000]
    102894298 (ABCC2)
Transporters [BR:pale02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    102894298 (ABCC2)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 RsgA_GTPase AAA_16 AAA_29 Dynamin_N MeaB DUF87 AAA_24
Other DBs
NCBI-GeneID: 102894298
NCBI-ProteinID: XP_006926069
LinkDB
Position
Unknown
AA seq 1542 aa
MEKFCNSTFWNSSLLDSPEADLPLCFEQTVLVWIPLGFLWLLAPWQLLHIYRSRTKRSST
TKLYLAKQVLVGFLFILAAIELALVFTEDSGQASVPAIRYTNPSIYLGTWLLVLLIQHSR
RWCVQKDSWFLSLFWILSILCDTFQFQTLIRMLLQGNNSSLAYSCLFFISYALQILILIL
SAFSEKDKLSDNPSFTASFLSSITFSWYDSIVLKGYKQPLTLKDVWDVDEKLKTKILVSK
FETVMAEELLKSRRAFQRRQQKKSQWNSGGSLNGLNKNQSQSQDVLVLEEAKKKQKKSKT
TEDFPKSWLVKTFFKIFYIIILKSLLLKLMNDILMFVSPQLLKLMISFANDRNTYVWVGY
IYSILLFAVASIQSICLQYHFQLCFVLGLNVRTIVMAAVYKKALILSNRDRKQYTIGETV
NLMSVDAQKLMDVANYIQMLWSTVLQIAFSIFFLWIELGPSVLAGVGLMAILIPVNAIFA
TKSRAIQVKNMENKDKRLKIMNEILSGIKILKYFAWEPSFKEKIHDIRKKELKNLLAYGQ
MQAMIMFFLYITPVLVSVVTFSVYVLVDSNNILDAEKAFTAISLFNILRYPMTILPMVIS
SVLQASVSIRRLEKYLGGDELDTSAIRHDCNFDTVVQFSEASFTWDQNSEATIQDVNLDV
RPGQLVAVVGTVGSGKSSLMSALLGEMENIHGHIAIKGTVAYVPQQSWIQNGTVKDNILF
GSELDEKRYQQVLEACALLPDLEVLPGGDLAEIGEKGINLSGGQKQRISLARAIYQNLDI
YILDDPLSAVDAHVGKHIFDKVLGPNGLLKDKTRLLVTHSIHFLPQVDEIVVLENGSISE
KGSYSTLLAKKGLFARNLKTFIKQTGPEGEATVNENSEEDDYGLMPSVEEIPEDVISLTM
KRENSLHRTLSHRSRSNSRHLKSLKDSLKTRSVNIPKEKEELVKGQKLIKKEFMETGKVK
FSVYLKYLQAVGWSSVFIIILAHIFNAVALIGSNLWLSAWTSDSKIFNSTNYPTSRRDMR
IGVYGALGLGQGIFVLIANLCSTCGFTHASNILHKQLLNKILRAPMSFFDTTPSGRIVNR
FSSDVSTMDDTLPASLRSWILYFLGIISTLLMICLATPVFVVIIIPLSIIYVLVQIFYVA
TSRQLRRLDSVTRSPVYSFFSETVSGLPVIRAFQHQQRFLKHSEVLIDNNQKCVFSWIIS
NRWLAIRLDLVGNLVVFFASLMMVIYRDNLSGDTVGFVLSNALSITQSLSWLVRLTSEIE
TNIVAVERINEYINVENEAPWVTDKRPPVGWPSKGEIQFRNYEVRYRPELDLVLKGITCD
IRSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQITIDGVDIASIGLHDLREKLTIIPQD
PILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVANLQLGLSHEVTEAGDNLSIGQRQ
LLCLARALLRKSKILIMDEATAAVDLETDRLIQMTIQKEFSHCTTITIAHRLHTIMDSNK
VMVLDHGKIVEYGSPEELLKKPGPFYFMAKEAGIENANSTTL
NT seq 4629 nt   +upstreamnt  +downstreamnt
atggagaagttctgcaactccactttttggaactcctcattgctggatagcccggaggca
gacctgccactttgttttgagcaaactgttctggtatggattcctttgggcttcctttgg
cttctggccccttggcagcttctccacatatatagatccagaaccaagagatcttctaca
accaaactctaccttgctaagcaggtgctcgttgggtttctttttattctagcagccata
gaactagctcttgtattcacagaagactctggacaagcctcagtccccgccattagatat
accaatccaagcatctacctgggcacatggctcctggttttgctgatccaacacagcagg
cgatggtgtgtgcagaaggactcttggttcctgtctttattctggattctctcaatactc
tgtgatactttccaattccagactctgattcggatgctgttacagggcaacaattccagt
ctggcctactcctgcctgttcttcatttcttatgcattacagatcctgatcttgatcctt
tcagcattttcagaaaaagataagctatcagataatccatcattcacggcttcatttctg
agtagcattacctttagttggtatgacagcattgttctgaaaggctataagcaacctctg
acactgaaagatgtctgggatgttgacgaaaagcttaaaaccaagatactagtcagcaaa
tttgaaacagtcatggcagaggagctgctgaagtccaggcgggcattccagagacggcag
cagaagaaatcccagtggaactccggaggcagcctgaacggcctgaacaagaaccagagc
caaagccaagacgtccttgtcctggaagaagctaaaaagaaacaaaagaaatctaagacc
acagaagactttcccaagtcctggttggtcaagaccttcttcaaaattttctacatcata
atcctgaaatcgttgctgctgaagctcatgaatgacatattaatgtttgtgagtcctcag
ctgctgaaattgatgatctccttcgcaaatgaccgtaacacctacgtgtgggttggatat
atctattcgatcctcttgttcgccgtggcctccatccagtctatctgccttcagtaccat
tttcaactgtgctttgttctgggcctaaatgtacggacaatcgttatggctgctgtatat
aaaaaggcactgatcctatccaaccgggacaggaagcagtacaccataggagaaacagtg
aacttgatgtctgtggatgcccagaagctcatggatgtggctaactatatccaaatgctg
tggtcaactgttctacagattgccttttccattttcttcctatggatagagttgggaccc
tcagtcttagcaggtgttgggttgatggcaatcctaatcccagttaatgcaatattcgcc
accaaaagtagggctattcaggtaaaaaatatggagaataaagataaacgtttaaagatc
atgaatgagattctcagtgggatcaagatcctgaaatatttcgcatgggaaccttcattc
aaagaaaaaatccatgacattcggaagaaagagcttaagaacctgctcgcctatgggcag
atgcaggctatgataatgtttttcttatacataactccagtcctggtatctgtggtcaca
ttttcagtttacgtccttgtggatagcaataatattttggatgcagaaaaggctttcacc
gccatctctctcttcaatatcctacgctatcccatgaccatactcccaatggtgatctcc
tctgtactccaggccagtgtttccatacgacggctggagaagtacttgggaggggatgag
ttggacacatctgccattcgacatgactgcaattttgacacagttgtgcagttttccgag
gcttcctttacctgggaccagaattcggaagccacaattcaagacgtgaacctggacgtt
aggccaggccagttagtggctgtggtgggcaccgtgggctctgggaaaagctccttgatg
tcagccttgctgggagaaatggaaaatatccacggtcacatcgccatcaagggcactgta
gcctatgtcccacagcagtcctggatccagaatggcaccgtaaaggacaacatccttttt
ggatcagagttggatgaaaagagataccagcaagttctggaggcctgtgccctcctccca
gacttggaagtgctgcctggaggagacttggctgagattggagagaagggtataaatctc
agtgggggtcagaagcagcggatcagcctggccagagctatctatcaaaatttagatatc
tatattttggatgaccccctgtcagctgtggatgctcatgtgggaaagcatatttttgat
aaggtcttgggtcctaatggcctattgaaagacaagactcgactcttggttacacacagc
atccactttcttcctcaagtggatgagattgtggttctggagaatggcagcatctcagag
aagggatcctacagcactctactggccaagaaaggattgtttgctaggaatctgaagaca
tttataaagcagacgggtcctgaaggagaagccacagtcaatgagaacagtgaagaagac
gactatggactgatgcccagtgtggaagaaatccctgaggatgtaatctccttgaccatg
aaaagagagaacagccttcatcgaacacttagccacagatctagatccaatagcaggcat
ctgaagtctctaaaagactccttgaagactcggagtgtgaatatcccaaaggaaaaggaa
gaactagtgaaaggacaaaagctaattaagaaggaatttatggaaactggaaaggtgaag
ttctccgtctacctgaaatacctacaagcagtaggatggtcttcagttttcatcatcatc
cttgctcatatattcaatgccgtggctttgattggatccaacctctggctcagtgcttgg
accagtgactctaaaatcttcaatagtaccaactacccaacctctcggagggacatgaga
attggtgtctatggagctctgggattagggcaaggtatatttgtgctcatagccaatctc
tgcagcacctgtggtttcacccatgcatcaaacatccttcacaagcaactgctgaacaaa
atccttcgagcgcccatgagtttttttgacacaacaccctcaggccggattgtgaacagg
ttttctagtgatgtttccacgatggatgacacccttcccgcgtccttgcgcagctggatt
ttgtacttcctggggataatcagcacccttctcatgatctgtttggccactccagtcttc
gtcgtcatcatcattcctcttagcatcatttatgtgcttgttcagatattttatgtggct
acttcccgccagctgagacgtctggactctgtcaccagatccccagtctactctttcttc
agtgagactgtgtcaggtttgcctgtcatccgcgcctttcagcaccagcagcgatttcta
aaacacagtgaagtattgattgacaataatcagaaatgtgtcttttcctggattatctcc
aacaggtggcttgcaattcgtctggacctggtcgggaacctggttgtcttctttgcttcc
ttgatgatggttatttatagagataacctaagtggagacacggtgggctttgttctgtcc
aatgcactcagtatcacacaaagcctgagctggctagtgaggttgacatcagaaattgag
accaacattgtggctgttgaacgaataaatgagtacataaatgtggaaaatgaggcaccc
tgggtgactgataagagacctccagtaggttggcccagcaaaggggagatccagtttaga
aactacgaagtacggtaccgaccagagctggatctggtactgaaagggatcacttgtgac
atcaggagcatggagaagattggtgtggtgggcaggacaggagctgggaagtcatccctg
acaaactgcctcttcagaatcctagaggctgcgggtggccagatcaccattgatggggta
gatattgcttccattgggctccatgacctccgagagaaactgaccatcatccctcaggat
cctatcctgttctctggaagcctgaggatgaatctggaccctttcaacaactactcagac
gaagagatatggaaggccctagagctggctcacctcaaatcctttgtggccaacctgcaa
cttgggttgtctcatgaagtgacagaggctggcgacaaccttagcatagggcagaggcag
ctactgtgcctggccagggctctgcttcggaaatccaagattctgatcatggatgaggcc
actgctgcagtggatctcgagacagatcgtcttatccagatgaccatccaaaaggagttc
tcccactgcacaactatcaccattgctcacaggctacataccatcatggacagcaacaag
gtaatggttctagatcatgggaagattgtagagtacggcagccctgaagaactgctcaaa
aaacctggccccttttatttcatggccaaagaagctggcattgaaaatgcgaatagcacg
acgttgtga

DBGET integrated database retrieval system