KEGG   Pteropus alecto (black flying fox): 102894490
Entry
102894490         CDS       T02993                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04115  p53 signaling pathway
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102894490 (PMAIP1)
   04215 Apoptosis - multiple species
    102894490 (PMAIP1)
   04115 p53 signaling pathway
    102894490 (PMAIP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102894490 (PMAIP1)
   05203 Viral carcinogenesis
    102894490 (PMAIP1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102894490 (PMAIP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102894490 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 102894490
NCBI-ProteinID: XP_006913772
UniProt: L5KJZ0
LinkDB
Position
Unknown
AA seq 54 aa
MPGKKARKNAQPSPPRAPAELEVECAIQFRRIGDKLNLRQKLLNLISKLFHSGT
NT seq 165 nt   +upstreamnt  +downstreamnt
atgcctgggaagaaagcgcgtaagaacgcgcagccgagccctccgcgggccccggcagag
cttgaagttgagtgtgccattcaattcaggagaattggagacaagctgaatttacggcag
aaacttctgaatctgatatccaaactcttccactcgggaacctga

DBGET integrated database retrieval system