KEGG   Pteropus alecto (black flying fox): 102894659Help
Entry
102894659         CDS       T02993                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00020  Citrate cycle (TCA cycle)
pale00190  Oxidative phosphorylation
pale01100  Metabolic pathways
pale01200  Carbon metabolism
pale04714  Thermogenesis
pale04932  Non-alcoholic fatty liver disease (NAFLD)
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05016  Huntington disease
Module
pale_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pale_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pale_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102894659 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102894659 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102894659 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102894659 (SDHB)
   05012 Parkinson disease
    102894659 (SDHB)
   05016 Huntington disease
    102894659 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102894659 (SDHB)
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102894659 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 102894659
NCBI-ProteinID: XP_006914375
UniProt: L5KFZ7
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MAAVVGVSLRRRFPATAFGGACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTKRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWLIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggtggtcggagtctccttgaggcgtcgattcccagccacagcctttggcgga
gcctgcctgcaggcctgccgaggggcccagacagctgcagccacagctccccgaatcaag
aaatttgccatctaccgatgggacccagataagactggagataaacctcatatgcaaact
tatgaaattgatttgaataaatgtggccccatggtgttggatgctttaatcaaaattaag
aatgaaatcgattctaccttgaccttccgaagatcatgcagagaagggatctgtggctct
tgtgcaatgaacatcaatggaggcaacacgctggcttgcaccaaaaggatcgacaccaac
ctcaacaaagtctcaaaaatctacccgcttccacatatgtatgtgataaaagatcttgtt
cctgatttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaagaag
gatgaatcccaggaaggcaagcagcagtatctgcagtccatagaagagcgcgagaaactg
gatgggctctacgagtgcatcctctgcgcctgctgcagcaccagctgccctagctactgg
tggaatggagacaagtatttggggcctgcggttcttatgcaggcctatcgctggttgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccgttctctctg
tatcgctgccacaccatcatgaactgcacacagacctgccccaaggggctgaatccaggg
aaagctattgctgaaatcaagaaaatgatggcaacttacaaggagaagaaggcgtcagct
taa

DBGET integrated database retrieval system