KEGG   Pteropus alecto (black flying fox): 102894818
Entry
102894818         CDS       T02993                                 

Gene name
CACNA1E
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04020  Calcium signaling pathway
pale04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102894818 (CACNA1E)
   04020 Calcium signaling pathway
    102894818 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102894818 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pale04040]
    102894818 (CACNA1E)
Ion channels [BR:pale04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102894818 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 102894818
NCBI-ProteinID: XP_015441742
LinkDB
Position
Unknown
AA seq 2316 aa
MARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNTGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISVRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRALEGLALGL
EKCEEERGSRGGSLKGDSGDLSSALDNQKSPLSLGKREPPWPARPCHGNCDPMQQEARGG
ETVVTFEDRARHRQSQRRSRHRRVRTEGKEPSSASRSRSASQERSLDDGTPADGEKGREP
RSSRGAKEPTIQEEERAQHLRRTNSLMVSRGSGLAGALDEADTPLVLPQPELDVGKDTAL
TEQEPEPEPEGSSEQALLGEVQLDVGRAISQSEPDLSCVTANTDKAATESTSVTVAIPDV
DPLVDSAVVHISSKTDGEASPLKEAELKEEEETLGKQPQQDKRETGKAMVPHSSMFIFST
TNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNRVLRYFDYVFTGVFT
FEMVIKMVDQGLILQDGSYFRDLWNILDFIVVVGALVAFALATNKGRDIKTIKSLRVLRV
LRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSS
KDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIVWALLTLFTVSTGEGWPQVLQHSV
DVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKN
ERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTIVLMMKYYSA
PCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDS
KLVNVGCFNMSFXKLFXXXXXXXARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAML
FFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKG
CEPDTTAPSGQSENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILG
PHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPV
AEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPM
PKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANANA
LPYLQQDPGSGLSGRGGYPAMRPLSPQEIFQLACMDPADDGQCQEQQSLEPEVSELKSVQ
PSNHGIYLPPDTQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEF
SMERSSENTYKSRRRSYHSSLRLSAHRLNADSGHKSDTHRSGGRERGRSKERKHLLSPDV
SRCNSEERGTQADWESPERRPSRSPSEGRSQTPNREGTGSLSESSIPSISDTSTPRRSRR
QLPPVPPKPRPLLSYSSLLRHTGSVSPPADGSEGGSLLTSQVLEGGEGGPPAPSSSRHTQ
QGPHPSPQRYISEPYLALHEDAHTSDCGEEETLTFEAAVATSLGRANTIXXXXXXRHSWQ
MPNGHYRRRRRGGPGPGMMCGGVGDLLSDTEEDDKC
NT seq 6951 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcgccaggccggggtcaggcgatggagactcggac
cagagcaggaacaggcaaggaaccccggtgcccgcctcggggcccgcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatctttggagaagataacattgtcaggaag
tacgccaagaagctcatcgattggccgccatttgagtacatgatcctggccaccatcatt
gccaactgcatcgtcttggccctggagcagcatcttcccgaggatgacaagaccccaatg
tctcgcagactggagaagacggaaccgtatttcattgggatcttttgctttgaagccggg
atcaaaatcgtggccctggggttcatcttccataagggctcctaccttcgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggccaccgcgggcacccacttc
aacacacatgtcgacctgaggaccctccgggccgtgcgcgtcctcaggcccctgaagctc
gtgtcagggattcccagcctgcagattgtgttgaagtccatcatgaaggccatggtgcct
cttctgcagatcggcctcctgctcttctttgccatcctcatgtttgccatcatcggcttg
gagttctacagtgggaagctgcaccgtgcctgcttcatgaacaattcaggtatcctagaa
ggattcgacccccctcacccatgcggtgtgcagggctgcccagccggttatgaatgcaag
gactggatcggccccaacgacgggatcacgcagtttgataacatcctctttgcggtgctg
accgtcttccagtgcatcaccatggaagggtggaccaccgtgctctacaacaccaatgat
gccttaggagccacctggaattggctatacttcatccctctcatcatcattggatccttc
tttgttctcaacctagtcctgggagtgctttccggggaatttgccaaagagagagagcga
gtggagaaccggagagctttcatgaaactgcggcgccagcagcagattgagcgagagctg
aacgggtaccgcgcctggatagacaaagcggaggaagtcatgcttgcggaagaaaataaa
aacactggaacatcagccttggaagtgcttcggagggcaaccatcaagcggagccggaca
gaggccatgactcgagactccagcgatgagcactgtgtcgacatctcctccgtgggcaca
cctctcgcccgagccagcatcaaaagcacaaaggtggacggggcctcctacttccggcac
aaggagaggcttctgcgcatctcggtccgccacatggttaaatcccaggtgttttactgg
attgtgctgagcctcgtggctctcaacaccgcctgcgtggccatcgtccaccacaaccag
ccccagtggctcacccacctcctctactatgcagagtttttgtttctgggactcttcctc
ctggagatgtccctgaagatgtatggcatggggccccgcctttatttccactcttcattc
aactgctttgatttcggggtcacggtggggagtatcttcgaagtggtctgggccatcttc
agacccggtacatcttttggaatcagtgtcctgcgggctctccggcttctaagaatattt
aaaataaccaagtactgggcctccctgcggaatctggtggtctccttgatgagttccatg
aagtctatcatcagtttgctcttcctcctcttcctcttcatcgtcgtctttgctctccta
gggatgcagctgttcggaggcaggtttaacttcaatgatgggactccgtcagcaaacttc
gacaccttccctgcagctatcatgactgtattccagatcctgacgggtgaggactggaac
gaggtcatgtacaatggcatccgctcccagggcggggtcagctcgggcatgtggtcggct
atctatttcatcgtgctcaccttgtttggaaactacacgctgctgaacgtgttcttggcc
atcgctgtggacaatctggccaacgcacaggagctgaccaaggatgaacaggaagaagaa
gaggccttcaaccagaaacacgctctacagaaggccaaggaggtcagcccgatgtctgcg
cccaacatgccctcgatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgcgggagcggaggcgccggcaccacatgtcggtgtgggagcag
cgcaccagccagctgaggaggcacatgcagatgtccagccaggaggccctcaacaaggag
gaggcgccacccatgaacccactcaaccccctcaacccgctgagccccctcaacccgctc
aacgcgcaccccagcctgtaccggagaccccgggccctggagggcctggccctgggcctg
gagaagtgcgaggaggagcgcggcagccgtggggggtccctcaagggggacagcggggac
ctctccagtgccctggacaaccagaagagccccttgtccctgggcaagcgggagccgccg
tggccggccaggccctgccatgggaactgtgatccgatgcagcaggaggctcggggaggg
gagactgtggtgacctttgaggaccgggccaggcacaggcagagccagcggcgaagccgg
caccgccgcgtccggacggagggcaaggagccgtcctcggcctcccggagccggtccgcc
agccaggagcggagtctggatgacggcacacctgctgacggggagaagggccgtgagccc
aggagcagccgcggggccaaggagcccacgatccaggaggaggagcgggcccagcactta
cggaggaccaacagtctgatggtgtccaggggctccgggctggctggggccctcgatgaa
gcggacacaccgctcgtcctgccccagccggagctggacgtgggcaaggacacggcgctg
acggagcaggagccggagccggagccggagggcagcagtgagcaggcgctgctgggggag
gtgcagctggacgtgggccgggccatcagccagagcgagcctgacctctcctgcgtcacg
gccaacacggacaaggccgccaccgagagcaccagcgtcaccgtcgccatccctgacgtg
gaccccttggtggactcggccgtggtgcacatcagcagcaagaccgatggtgaagccagc
ccgttgaaggaggcggagctcaaagaggaggaggagacgctggggaagcagccgcagcag
gacaagcgagagacgggcaaagccatggtgccccacagctccatgtttatcttcagcacc
accaacccgatccgcagggcttgccactacatcgtgaacctgcgctactttgagatgtgt
atcctcctggtgatcgcggccagcagcattgccctggcggccgaggaccccgtcctgacc
aactcggagcgcaacagagtcctgcggtatttcgactacgtcttcactggcgtgttcacc
ttcgagatggtgataaagatggtagaccagggcctgattctgcaggatggatcctacttc
cgagacctgtggaacatcctcgacttcatcgtcgtggtcggtgcactagtggcctttgct
ttggcaaccaacaaagggcgggacatcaagaccatcaagtccctgcgggtgctgcgggtg
ctgcggccgctgaagaccatcaagcgcttgcccaagctcaaggccgtcttcgactgcgtg
gtgacctccctgaagaatgtcttcaacatcctcatcgtctacaagctcttcatgttcatc
tttgccgtcatcgcagttcagcttttcaagggcaagttcttttattgcacagacagttcc
aaggacacggagaaagagtgcataggcaactatgtcgatcacgagaaaaacaagatggag
gtgaaaggtcgggaatggaagcgccacgagttccactatgacaacatcgtctgggccctg
ctgaccctcttcaccgtctccacgggggaagggtggcctcaagtcctgcagcactccgtc
gacgtgacggaggaagaccgaggcccgagtcgcagcaaccgcatggagatgtccatcttc
tacgtcgtctacttcgtcgtcttccctttcttctttgtcaacatcttcgtggctctcatc
atcatcaccttccaggagcaaggggacaagatgatggaggagtgcagcctggagaagaac
gagagggcatgcatcgacttcgccatcagcgccaagcccctcacgcgctacatgccgcag
aacaggcacaccttccagtaccgcgtctggcacttcgtggtgtcgccgtccttcgagtac
accatcatggccatgatcgccctcaacaccatcgtgctgatgatgaagtactactccgcc
ccctgcacctacgagctggcgctgaagtacctgaatatcgccttcaccatggtgttttcc
ctggaatgtgtcctgaagatcatcgcctttggcttcttgaactacttccgagacacctgg
aatatcttcgacttcatcaccgtgatcggcagcatcacagaaatcattctgacagacagt
aagctggtgaacgtgggttgcttcaacatgagctttnngaagctcttcnnnnnnnnnnnn
nnnnnnnnngcccgcctcatcaagcttctgcgtcagggctacaccattcgcattttgctt
tggaccttcgtgcagtcctttaaggctctcccctacgtctgccttctgatcgccatgctt
ttcttcatctacgccatcatcgggatgcaggtgtttgggaacataaaactagatgaggag
agtcacatcaaccggcacaacaacttccggagtttctttgggtccctcatgctgctcttc
aggagcgccacaggggaggcctggcaggagataatgctgtcgtgcctcggggagaaaggc
tgtgagcccgacaccacagcgccgtcagggcagagcgagaatgagcgctgtggcaccgat
ctggcctacgtgtacttcgtctccttcatcttcttctgctccttcctgatgctcaacctg
tttgtggccgtcatcatggacaacttcgagtacctgactcgggactcgtccatcctgggg
cctcaccacctggatgagtttgtccgcgtctgggcagaatatgacagagctgcatgtggc
cgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctc
ggcaagagatgtccctccaaagtggcgtataagaggttggttctgatgaatatgccagta
gctgaggacatgacagtccactttacctccaccctgatggctctgatccggacagctctg
gacatcaaaatcgccaaaggcggtgctgacaggcagcagctagactcggagctacagaag
gagaccctggccatctggcctcacctgtcccagaagatgctagatctgcttgtgcccatg
cccaaagcctctgatctgaccgtgggcaaaatctatgcagcgatgatgatcatggactac
tataaacagagtaaggtgaagaagcagaggcagcagctggaggaacagaaaaatgcgccc
atgttccagcgcatggagccctcatctctgcctcaggagatcatcgccaacgccaacgcg
ctgccctatctgcagcaggacccgggttcaggcctgagcggccgcggcggataccctgcg
atgcgcccgctctccccgcaggaaatattccagctggcgtgcatggacccggccgacgac
ggacagtgccaggagcagcagtctctggagccagaggttagtgaattaaaaagcgtgcag
ccctctaaccatggcatctaccttcctccggacacccaggagcatgcgggatctgggagg
gcatcctctatgccacgcctgactgtggatccccaggtggtaacagaccccagctccatg
agacgttcgttctctactatccgggataagcgttcgaattcctcatggttggaggaattc
tccatggagcgaagcagcgagaacacctataagtcccgtcgccggagctaccactcctcc
ctgcggctgtcggcccaccgcctgaacgccgactcgggccacaagtccgacacccaccgc
tccgggggcagagagcggggacgatcgaaagagcgaaagcatctcctctctcctgacgtg
tcccgctgcaactccgaggagcgaggcacccaggcggactgggagtccccggagcgccgt
ccgtcccggtcccccagcgagggcaggtcgcagacccccaacagagagggcacaggctcc
ttgagcgaaagctccatcccctccatctctgacaccagcaccccaaggcgaagtcgtcgg
cagctccccccggtccctccaaagccgcggcccctcctttcctacagctccctgctccga
cacacgggcagcgtctctccccccgccgatggcagcgagggcggctccctcctgacctcc
caagtcctggagggcggcgaggggggcccgcccgcgccctccagctcccggcacacgcag
cagggcccgcacccttccccgcagcgctacatctccgagccctacctggccctgcacgaa
gacgcccacacctcggactgtggcgaggaggagacgctcaccttcgaagccgctgtggcc
accagcctgggccgtgccaacaccatcnnnnnnnnnnnnnnnnngcggcacagctggcag
atgcccaacgggcactaccggcggcggaggcgtggggggccggggccgggcatgatgtgc
ggaggtgtcggcgacctcctgagtgacacagaagaagacgacaagtgctag

DBGET integrated database retrieval system