KEGG   Pteropus alecto (black flying fox): 102894909Help
Entry
102894909         CDS       T02993                                 

Gene name
SMARCC1
Definition
(RefSeq) SWI/SNF complex subunit SMARCC1
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04714  Thermogenesis
pale05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pale00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102894909 (SMARCC1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102894909 (SMARCC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pale03021]
    102894909 (SMARCC1)
   03036 Chromosome and associated proteins [BR:pale03036]
    102894909 (SMARCC1)
Transcription machinery [BR:pale03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     102894909 (SMARCC1)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    102894909 (SMARCC1)
   PBAF complex
    102894909 (SMARCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM-assoc_3 SWIRM SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6 BRCT_2 DUF919 DUF2618
Motif
Other DBs
NCBI-GeneID: 102894909
NCBI-ProteinID: XP_006914941
LinkDB All DBs
Position
Unknown
AA seq 1050 aa AA seqDB search
MSWAVLRGDCQYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKA
GGTLCHILGAAYKYRNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQSNCLTRPNIYLIP
DIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYPSSQEDEEWLRPVMRKDKQMLVHWG
FYPDSYDTWVHSNDVDAEVEDPPIPEKPWKVHAKWILDTDIFNEWMNEEDYEVDENRKPV
SFRQRISTKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTESRKKSGKKGQASLYGK
RRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNPKKDSENTPVKGGTVADLDEQDEE
TVTTGGKEDEDPGKGDQSRSVDPGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEF
FNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGL
VNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPI
DLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQ
DECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAA
AKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTFGLESSCIAGTGPDEPEKLE
GTEEEKMETDTDVQQPEKAENKGENEVDESDKAQDGDNEKTSEKEQDSEVSEDAKSEEKE
TEENKELTDVCKERESDIGKRKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKS
LVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRA
RQQMEQQQHGQNPPQAHQHSGPGLAPLGAAGHPSMMPHQQPPPYPLMHHQMPPPHPPQPG
QIPGPGSMMPGQPMPGRMIPTVAANIHPPGGGPAAPGMPPMPGNVLGPRVTLTAPNGMYP
PPPQQPPPPPPPADGVPPPPAPGPPASAAP
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggcggtgctacgcggagactgtcaatatgttcatgcagacgcccctaccaat
aaaacactggctgggctggtggtgcagctcctccagtttcaggaagatgcctttgggaag
cacgtcaccaacccggccttcaccaaactccctgcaaaatgtttcatggatttcaaagct
ggaggcaccttgtgtcacattcttggagctgcttacaagtatagaaatgaacagggctgg
cggaggtttgatctacagaatccatcccgaatggatcgtaatgttgagatgtttatgaac
attgaaaaaacattggtgcagagcaactgcctgaccagacccaacatctacctcattcca
gacattgatctgaagttggctaacaaattgaaagatatcatcaaacgacatcaggggaca
tttactgatgagaagtcaaaagcttcccaccacatttatccatatccttcctcacaagag
gatgaagagtggttgcgacctgtgatgagaaaagacaagcagatgttagtgcattggggg
ttttacccagacagctatgatacttgggtccatagtaatgatgttgatgcggaagttgaa
gatccaccaattccagaaaagccatggaaggttcatgcaaaatggattttggacactgac
attttcaatgaatggatgaatgaggaggattatgaggtggatgagaacaggaagcctgtg
agttttcgtcagcgaatttcaacaaaaaatgaagagccagtcagaagtccagagagaaga
gatagaaaagcatcagctaatgctcgaaagaggaaacattcgccttcccctccccctccc
acacccacagagtcacggaagaagagcgggaagaaaggccaggctagtctttatgggaag
cgcagaagtcagaaagaggaagatgagcaagaagatcttaccaaggacatggaggaccca
acacctgtacccaacatagaggaagtggtacttccaaaaaatgtaaatccaaagaaagat
agtgaaaatacacctgttaaaggaggaactgtagcagatctagatgagcaggatgaagag
acagtcacaacaggaggaaaggaagatgaggatcccggcaaaggtgatcagagtcggtcc
gttgaccctggtgaagataatgtcacagagcaaaccaatcacattattattcctagctat
gcgtcgtggtttgattataactgtattcatgtgattgaacggcgtgctcttcctgagttt
ttcaatggaaagaataagtccaagactccagagatatacttggcatatcgaaattttatg
attgacacatatcgcctaaaccctcaagaatatttaaccagcactgcttgtcggaggaat
ttgactggagatgtgtgcgctgtgatgagggttcatgcctttttagagcaatgggggctt
gttaattaccaagtggatccagaaagtcgacccatggccatggggcctcctcctactcct
catttcaatgttttggctgataccccctctgggcttgtgcctctacatcttcgatcacct
caggtccctgctgctcagcagatgttaaattttcctgaaaagaacaaggaaaaaccaatt
gatttgcagaactttggtctccgtactgacatttactccaagaaaaccttagcaaagagt
aaaggtgctagcgctggacgagaatggaccgaacaggagacgcttctgctgctggaggcc
ctagagatgtacaaggatgattggaacaaagtgtcagaacatgttggaagtcgcactcag
gatgaatgcatcctccactttttgaggcttcccatcgaggacccataccttgagaattca
gatgcttcccttgggcccctggcctaccagcctgtcccctttagtcagtcaggaaaccca
gtcatgagcaccgttgcctttttggcatctgtggtggaccctcgtgtggcatctgctgcg
gcaaaagcggctttggaggagttttctcgggtccgggaggaggtgccactggaattggtt
gaggctcacgtcaagaaggtgcaagaagcagctcgagcctctgggaaagtggaccccacc
tttggcctggagagcagctgcattgcaggcacggggcctgacgagccagaaaagcttgaa
ggaactgaagaggaaaaaatggaaacagatactgatgttcagcagcctgaaaaggcagaa
aacaaaggggagaacgaagtggatgaaagcgataaagcacaagatggagacaatgaaaaa
actagtgagaaggagcaggatagtgaagttagtgaggacgccaaatcagaggaaaaggag
accgaagagaacaaggagctcactgatgtttgtaaagaaagagagagcgatatcgggaag
aggaaagtagaacatgaaatttctgaaggaaacgtggccacggctgctgcagctgccctg
gcctccgctgcgaccaaagccaagcacctggctgccgtggaagagagaaagatcaagtct
ctggtagctctcctagttgagacacagatgaagaaactggagatcaaacttcggcatttt
gaggagctggaaacgatcatggacagagaaaaagaggctttagaacagcagaggcagcag
ttgcttacggaacgccagaacttccacatggaacagctgaaatacgcggagttgcgagcc
cgccagcaaatggaacagcagcagcatgggcagaacccacctcaggcacaccagcactca
ggacctgggctggcaccgctgggagcagcagggcaccccagcatgatgccccatcagcag
ccccctccctaccctctgatgcaccaccagatgccgccgcctcaccccccacagccaggt
cagataccaggcccaggttccatgatgcctgggcagcccatgccaggccgaatgattccc
accgtggcagccaacatccacccccctgggggtggccctgccgctcctggtatgcctccg
atgccagggaacgtcttaggaccccgcgtaaccctcacggcacctaacggcatgtatccc
cctccaccgcagcagccgccgccgccaccaccgcccgcagatggagtccctccacctcct
gctccaggtccaccagcctcggccgcaccctag

DBGET integrated database retrieval system