KEGG   Pteropus alecto (black flying fox): 102894970
Entry
102894970         CDS       T02993                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2
  KO
K03259  translation initiation factor 4E
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale03013  RNA transport
pale04066  HIF-1 signaling pathway
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04211  Longevity regulating pathway
pale04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102894970 (EIF4E2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102894970 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    102894970 (EIF4E2)
   04150 mTOR signaling pathway
    102894970 (EIF4E2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102894970 (EIF4E2)
  09149 Aging
   04211 Longevity regulating pathway
    102894970 (EIF4E2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102894970 (EIF4E2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pale03019]
    102894970 (EIF4E2)
   03012 Translation factors [BR:pale03012]
    102894970 (EIF4E2)
Messenger RNA biogenesis [BR:pale03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     102894970 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102894970 (EIF4E2)
Translation factors [BR:pale03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    102894970 (EIF4E2)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 102894970
NCBI-ProteinID: XP_024898955
LinkDB
Position
Unknown
AA seq 292 aa
GAETAAVWVFPQPGHLGIAASSFPHTPVPPWAAHLSCLSLSFLTGKVGTVIEPVSYSCED
AVRLKDDDSGDHDQNEENSTQKDGEKEKMERDKSQSISKRKAVVPGPAEHPLQYNYTFWY
SRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMW
EDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWN
KTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEEFHGLVNSSGR
NT seq 879 nt   +upstreamnt  +downstreamnt
ggggcggagaccgcggcggtttgggtgtttccgcagcccggccacctcggaattgctgca
tccagcttccctcacactcccgttccgccttgggccgctcatctctcctgtctgagtctc
agttttctcaccggcaaagtggggacggtgatagagcccgtgtcatatagttgtgaggat
gcagtgagattgaaagatgatgacagtggggaccatgaccagaatgaagaaaacagcaca
cagaaagatggtgagaaggaaaaaatggaacgagacaagagtcagagcatcagcaagagg
aaggctgttgtccctggaccagcagagcatcccctgcagtacaactacactttctggtac
tccaggagaacccccggccgtcccaccagctcacagagctatgagcagaatattaaacag
attggcacctttgcctctgtggaacagttctggaggttttacagccacatggtacgtccc
ggggacctgacaggccacagtgacttccatctcttcaaagaaggaattaaacctatgtgg
gaggatgatgcaaataaaaatggcggcaagtggattattcggctacgaaagggcttggcc
tcccgttgctgggagaatctcatcctggccatgttgggggagcagttcatggttggggaa
gagatctgtggggctgtggtctccgtccggtttcaggaggacattatttccatatggaat
aagactgccagcgaccaagccaccacagcccgaatccgggatacgcttcggcgagtgctt
aacctacctcccaacaccattatggaatacaaaacccacaccgacagcatcaaggcctgg
gaggagtttcatggcctggtgaacagcagcggccgctga

KEGG   Pteropus alecto (black flying fox): 102898578
Entry
102898578         CDS       T02993                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale03013  RNA transport
pale04066  HIF-1 signaling pathway
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04211  Longevity regulating pathway
pale04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102898578 (EIF4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102898578 (EIF4E)
   04151 PI3K-Akt signaling pathway
    102898578 (EIF4E)
   04150 mTOR signaling pathway
    102898578 (EIF4E)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102898578 (EIF4E)
  09149 Aging
   04211 Longevity regulating pathway
    102898578 (EIF4E)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102898578 (EIF4E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pale03019]
    102898578 (EIF4E)
   03012 Translation factors [BR:pale03012]
    102898578 (EIF4E)
Messenger RNA biogenesis [BR:pale03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     102898578 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102898578 (EIF4E)
Translation factors [BR:pale03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    102898578 (EIF4E)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 102898578
NCBI-ProteinID: XP_006910814
LinkDB
Position
Unknown
AA seq 217 aa
MATVEPETTPTPNPPPTEEDKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctactcctaatcccccgcctacagaagaagat
aaaacagaatctaatcaggaggttgctaacccagaacactatattaaacatcctttacag
aacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cggctgatctctaagtttgatactgttgaagacttttgggctctgtacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgagaaaaacaaacgaggaggacgatggctaattacattgaacaaacag
cagagacgaagtgaccttgatcgcttttggctagagacactgctgtgccttattggagaa
tcttttgatgactacagtgatgatgtatgtggagctgttgttaatgttagagctaaaggg
gataagatagcaatatggactactgaatgtgaaaacagagaagctgttacacatataggg
agggtatataaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccat
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

KEGG   Pteropus alecto (black flying fox): 102898723
Entry
102898723         CDS       T02993                                 

Gene name
EIF4E1B
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 1B
  KO
K03259  translation initiation factor 4E
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale03013  RNA transport
pale04066  HIF-1 signaling pathway
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04211  Longevity regulating pathway
pale04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102898723 (EIF4E1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102898723 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    102898723 (EIF4E1B)
   04150 mTOR signaling pathway
    102898723 (EIF4E1B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102898723 (EIF4E1B)
  09149 Aging
   04211 Longevity regulating pathway
    102898723 (EIF4E1B)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102898723 (EIF4E1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pale03019]
    102898723 (EIF4E1B)
   03012 Translation factors [BR:pale03012]
    102898723 (EIF4E1B)
Messenger RNA biogenesis [BR:pale03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     102898723 (EIF4E1B)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102898723 (EIF4E1B)
Translation factors [BR:pale03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    102898723 (EIF4E1B)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 102898723
NCBI-ProteinID: XP_024896375
LinkDB
Position
Unknown
AA seq 286 aa
MATNSPVGPSAYPSCSKGQVGLGRLGSQPTLTLFFGQLREAESGLRKWEKEEKEKEKEKE
EEEEEKEAAAARPSAGEEALGSPQALLSLRREARDEGPVGVKPELHLLQSRWALWFFKND
RSRAWQDNLHLVTKFDTVEDFWAVYSHIQLASKLSSGCDYALFKDGIEPMWEDPRNKRGG
RWLVSLAKQQRHIKLDRLWLETLLCLIGESFEEYSREVCGAVINIRTKGDKIAVWTREAE
NQTGVLHIGRVYKEHLGLSTKTIIGYQAHADTATKSNTLAKNKFVV
NT seq 861 nt   +upstreamnt  +downstreamnt
atggccaccaacagccctgtaggtccatctgcctatccctcctgcagcaaggggcaggtg
gggctggggcggctgggctcacaacccaccctgactcttttctttggtcagctcagagag
gctgagagtggactccgaaagtgggagaaggaagagaaagagaaagagaaagagaaagaa
gaagaggaagaggaaaaggaggcagctgcagcgcggccctcagcaggagaggaggctctg
ggctctccccaggctctgctgtccctgaggagagaggcccgggatgagggccccgtcgga
gtcaagcctgagttgcaccttctgcagagcaggtgggctctgtggttcttcaagaatgac
cgcagccgggcctggcaggacaacctgcatctggtcaccaagtttgacactgtggaggac
ttctgggcggtgtacagtcacatccagctggccagtaagctctcgtctggctgcgactat
gccctgttcaaggatggcatcgagcccatgtgggaagaccccaggaataagcggggtggc
cgttggctggtcagccttgccaaacagcagcgccacatcaagctggaccgcctgtggctg
gagacactgctgtgtctcatcggggagagctttgaagagtacagccgggaggtgtgtggg
gctgtcatcaacatccgcactaagggggacaagattgcggtgtggactcgggaggcagag
aaccagacgggcgtgctccacattgggcgtgtctacaaagagcacttgggactctccaca
aagaccatcattggataccaggcccacgcagacacggccaccaagagcaacaccctagcc
aagaacaagtttgtggtgtga

DBGET integrated database retrieval system