KEGG   Pteropus alecto (black flying fox): 102895362
Entry
102895362         CDS       T02993                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04014  Ras signaling pathway
pale04015  Rap1 signaling pathway
pale04020  Calcium signaling pathway
pale04072  Phospholipase D signaling pathway
pale04144  Endocytosis
pale04151  PI3K-Akt signaling pathway
pale04510  Focal adhesion
pale04540  Gap junction
pale04630  JAK-STAT signaling pathway
pale04810  Regulation of actin cytoskeleton
pale05163  Human cytomegalovirus infection
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05214  Glioma
pale05215  Prostate cancer
pale05218  Melanoma
pale05230  Central carbon metabolism in cancer
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102895362 (PDGFRA)
   04014 Ras signaling pathway
    102895362 (PDGFRA)
   04015 Rap1 signaling pathway
    102895362 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102895362 (PDGFRA)
   04020 Calcium signaling pathway
    102895362 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102895362 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102895362 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102895362 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102895362 (PDGFRA)
   04540 Gap junction
    102895362 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102895362 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102895362 (PDGFRA)
   05206 MicroRNAs in cancer
    102895362 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102895362 (PDGFRA)
   05231 Choline metabolism in cancer
    102895362 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102895362 (PDGFRA)
   05218 Melanoma
    102895362 (PDGFRA)
   05215 Prostate cancer
    102895362 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102895362 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102895362 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102895362 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pale04090]
    102895362 (PDGFRA)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102895362 (PDGFRA)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102895362 (PDGFRA)
CD molecules [BR:pale04090]
 Proteins
  102895362 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 102895362
NCBI-ProteinID: XP_006922566
UniProt: L5JZI7
LinkDB
Position
Unknown
AA seq 1088 aa
MGTSHPALLVLGCLLAGPSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
LFDENSNVEIRNEENNSGLFVTVLEVVNASAAHTGLYTCYYNHTQTEENEIEGRRIYIYV
PDPDVAFVPLGMTDYLVIVEDDDFAIIPCRTTDPDTPVTLLGSDGVVLASYDSRQGFNGT
FTVGLYICEATVRGRKFQTIPFNVYALKATSELDLEMEAPKTVYKSGETVVVTCAVFNNE
VVDLQWTYPGEVRGKGVTTLEETKVPFIKLVYTLRVPGATVKDSGEYGCAARQATREVKE
MKKVTISVHEKGFIEIKPNFSQLEAVNLHEVKHFVVDVQAYPPPRISWLKDNLTLIENLT
EITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIIVQNEDDAKSYTFELLTQVPSSILDLV
DDHHGATGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNISNIVTEVHLRDR
STVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVIIS
LIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGS
GAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLL
GACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSYV
ILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNL
LSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLAR
DIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMV
DSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKS
YEKIHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIP
LPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSS
DLVEDSFL
NT seq 3267 nt   +upstreamnt  +downstreamnt
atggggacttcccatcccgcactcctggtcttaggctgtctccttgcagggccgagccta
atcctctgccagctttcattaccctctatcctcccaaacgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagcgaagtgagctggcagtacccc
ttgtttgacgagaactccaacgtggaaatcagaaatgaggagaacaacagtggccttttt
gtgaccgtgctggaagtggtcaatgcctcggcagcccacacggggctgtacacttgctat
tacaaccacacgcagacagaagaaaatgagattgaaggtcggcgcatttacatctacgtg
ccagacccagatgtagcctttgtacctttgggaatgacagattatttagtcatcgtggaa
gacgatgactttgccatcataccttgtagaacaaccgaccccgatactccggtaacttta
ctcggcagtgatggggtggtcctcgcctcctatgacagcagacagggctttaatggaacc
ttcaccgttgggctctatatctgcgaggccaccgtcagagggaggaagttccagaccatt
ccatttaatgtttatgctttaaaagcaacatcagaacttgatctagaaatggaagctcct
aaaactgtgtataagtcaggagaaacggttgtggtcacctgtgccgtctttaacaacgag
gtggttgaccttcagtggacttatcctggagaagtgaggggcaaaggcgtcacgacgctg
gaggaaaccaaggtccccttcatcaagctggtgtacacactgagggtccctggggccaca
gtgaaagacagtggagagtacggatgtgccgcccgccaggccaccagggaggtcaaagaa
atgaagaaagtcaccatttctgtccatgagaaagggttcattgaaatcaaacccaacttc
agccagttggaagctgtcaacctgcatgaagtcaaacatttcgtggtggacgtgcaggcc
tacccccctcccaggatatcctggctgaaagacaacctgactctgattgaaaacctcacc
gagatcaccactgacatagaaaagattcaggaaataaggtatcgaagcaaattaaagctg
attcgtgctaaggaagaagacagtggccattatactattatagttcaaaatgaagatgat
gcgaagagctatacttttgaactcttaactcaagttccctcatctattctggacttggtc
gacgatcaccatggcgctacagggggacagactgtgagatgcacagctgaagggacacct
cttcctgatattgaatggatgatttgcaaggatattaagaaatgtaataatgagacttca
tggacgattttggccaacaacatctcaaacatcgtcacggaggtccacctccgggacagg
agtacggtggagggccgggtgacgttcgccaaagtggaggagactattgcggttcgatgt
ctggctaagaatcttcttggggctgagaaccgagagctgaagctggtggctcccactctg
cgttctgaactcacggtggcagccgcagtcctggtgctcttggtgattgtgatcatctca
ctgattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagggtc
attgaatcaatcagccccgatggacatgaatatatttatgtggacccgatgcagctgcct
tatgactcgagatgggagtttccaagagatggactagtgctgggtcgtatcctgggatct
ggtgcatttgggaaagtggttgaaggaactgcctatggattaagccggtcccaacctgtc
atgaaagtggcagtaaagatgcttaaacccacagccagatccagtgaaaaacaagctctc
atgtctgaactgaagataatgactcacctggggccgcatttaaacattgtaaacttgctg
ggagcctgtaccaagtcaggccccatttacatcatcactgagtactgtttctatggggat
ttggtcaactatttgcataagaatagagacagcttcctgagccgccacccagagaagcca
aagaaagagctggacatcttcggattgaaccccgctgatgaaagcacgcggagttatgtt
attttatcttttgaaaacaatggtgactacatggacatgaagcaagctgataccacacag
tatgtccccatgctggaaaggaaagaggtttctaaatattcagacatccagagatcgctg
tatgatcgcccagcctcatataagaagaaatctatgttagattcggaagtcaaaaacctt
ctttcagatgataactcggaaggccttactttgttggatttgttgagctttacctatcag
gttgcccgaggaatggaatttttggcttcaaaaaattgtgtccaccgggacctggccgct
cgcaacgtcctcctggcacaagggaaaattgtgaagatctgtgactttggcctggccaga
gatattatgcacgattccaactacgtgtcgaaaggcagtaccttcctccctgtgaagtgg
atggctcctgagagcatcttcgacaacctctacaccacactgagcgacgtctggtcttac
ggcattctgctgtgggagatcttttcccttggtggcacaccctacccaggcatgatggtg
gattctactttctacaacaagatcaagagtgggtaccgaatggccaagcctgaccacgcc
accagtgaagtctatgagatcatggtgaagtgctggaacagtgagccggagaagagaccc
tccttttaccacctgagtgaaattgtggagaacctgctgcctggacaatataaaaagagt
tatgaaaagattcacctggacttcctgaagagtgaccatccggcggtggcacgcatgcgc
gtggacgctgacaatgcctacattggtgtcacctataaaaatgaagaggacaaactgaag
gactgggagggtggccttgatgagcagaggctgagtgcagacagcggctacatcatccct
ctgccggacatcgaccccgtgcctgaggaagaagacctgggcaagagaaacagacatagc
tcacagacctccgaagagagtgccattgagacaggttccagcagttctaccttcatcaag
agagaggatgagaccattgaagacatcgacatgatggatgacattggtatagactcctca
gacctagtggaagacagcttcctgtaa

DBGET integrated database retrieval system