KEGG   Pteropus alecto (black flying fox): 102895392
Entry
102895392         CDS       T02993                                 

Gene name
ERBB3
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04020  Calcium signaling pathway
pale04151  PI3K-Akt signaling pathway
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102895392 (ERBB3)
   04012 ErbB signaling pathway
    102895392 (ERBB3)
   04020 Calcium signaling pathway
    102895392 (ERBB3)
   04151 PI3K-Akt signaling pathway
    102895392 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102895392 (ERBB3)
   05205 Proteoglycans in cancer
    102895392 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102895392 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102895392 (ERBB3)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102895392 (ERBB3)
Protein kinases [BR:pale01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102895392 (ERBB3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like SKG6
Other DBs
NCBI-GeneID: 102895392
NCBI-ProteinID: XP_006908943
LinkDB
Position
Unknown
AA seq 1339 aa
MRANGALQVLGFLLSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAAIVVKDNG
RNCPLCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRLFNDSGACVRQCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKICEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNITSLGLRSLKEISAGRIYISANRQLCYHHSLNWTRLLRGPSEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPAQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHNDECFSCHPECQPMEGTATCNGSGSDACAQCAHFRDGPHCVSSCPYGVLGAKGPI
YKFPDAQNECRPCHENCTQGCKGPDLQDCLGQTRALISKTHLAMALAVVVGLVVIFVILG
SSILYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGAGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIPPGAEPPALTNKELEEVELEPELDLDLDLEAEED
NLVTTLGSALSLPLGTLNRPRGSQSFLSPSSGYMPMNQNNLGEACQESAVCGGSELCPRP
ASLHPLPRGRLVSESSEGHVTGSEAELQEKVSLCRSRSRSPRPRGDSAYHSQRHSLLTPV
TPVSSPGLEEEDVNGYVMPDAHLKGTPSSREGTLSSVGLNSVLGTEEDDEDEEYEYMNRR
RRHTPPRPPRPGSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDYEYM
NKRRGGGGPGGDYAAMGACPAAEQGYEEMRAFQGPGHHAPHVHYARLKTLRSLEATDSAF
DNPDYWHSRLFPKANAQRT
NT seq 4020 nt   +upstreamnt  +downstreamnt
atgagggcgaacggggctctacaggtgctgggcttccttctcagcctggcccggggctcc
gaggtgggcaactcgcaggcagtatgtcctgggactctgaatgggctgagtgtgactggc
gatgccgagaaccaataccagacactgtacaagctctacgagaggtgtgaggtggtgatg
gggaacctcgagattgtgctcacaggacacaatgctgacctctctttcctgcagtggatc
cgagaagtgaccggctatgtccttgtggccatgaatgagttctctgtactgcctctgccc
aacctccgagtggtacgggggacccaggtctacgatgggaagtttgccatctttgtcatg
ttgaactataacaccaactccagccatgctctccgccagctccgctttacacaactcact
gagattctgtccgggggtgtttatattgagaagaatgataaactttgtcacatggacaca
attgactggagggacatcgtgagggaccgagatgccgcgatagtggtgaaggacaatggc
aggaactgtcccctctgtcatgaggtctgcaaggggcgatgctggggtcctgggccagaa
gactgccagacattgaccaagaccatctgtgctcctcagtgtaatggtcattgctttggg
cccaaccccaaccagtgctgccatgatgagtgtgcagggggctgctcaggccctcaggac
acagactgctttgcctgccgactcttcaatgacagtggagcctgtgtacgccagtgtcca
cagcctcttgtctacaacaagctaactttccagctggaacccaatcctcataccaagtat
cagtatggaggagtttgtgtagcaagctgtccccataactttgtggtggatcaaacgtct
tgtgtcagggcctgtcctcctgacaagatggaagtagataaaaatgggctcaagatatgt
gaaccttgtggggggctgtgccccaaagcctgtgaagggacgggctctgggagccgcttt
cagactgtggactctagcaacattgatggatttgtgaactgcaccaagattctgggcaac
ctggactttctcatcactggcctcaatggagacccctggcacaagatccctgccctggac
cctgagaagctcaatgtcttccggacagtacgggagattacaggttacctgaacatccag
tcctggcctccccacatgcataacttcagtgtcttttccaacctgacaaccatcgggggc
agaagcctctacaaccggggattctcattgttgattatgaagaacttaaatataacatct
ctgggcctccgatccttaaaagaaattagtgctgggcgtatctacataagtgccaatcgg
cagctctgctaccaccattctctgaactggaccaggctgcttcgagggccttcagaagag
agactagacatcaagcataatcgaccccgcagagactgcgtggcagagggcaaagtgtgt
gacccactgtgctcctccgggggatgctggggcccaggccctgctcagtgcctatcctgt
cgaaactacagccgaggaggtgtctgcgtgacccactgcaactttctgaatggggagcct
cgcgagtttgcccataatgatgaatgcttctcctgccacccggaatgccaacccatggag
ggcactgccacatgcaatggctcgggctctgatgcttgtgcccagtgtgcccattttcga
gatgggccccactgtgtgagcagctgcccctatggagttttgggtgccaagggccccatc
tacaagtttccagatgctcagaatgaatgtcggccctgtcatgagaactgtacccagggg
tgtaaaggaccagacctgcaagactgtttaggccagacacgggcattgatcagcaaaacc
catctggcaatggctttagcagtggtagtaggattggtagtgattttcgtgatcctgggc
agcagtattctttattggcgtgggcgccggattcagaataagagggctatgaggcgctac
ttggaacggggtgagagcatagagcctctggatcccagtgagaaggctaacaaagtcttg
gccagaatcttcaaggagacagagctgaggaagcttaaagtgcttggtgcaggcgtcttt
ggaactgtgcacaaaggagtgtggattcctgagggtgaatcaataaagattcccgtctgc
attaaagtcattgaggacaagagtggacggcaaagttttcaagctgtgacggatcatatg
ctggccattggcagcctagaccatgcccacattgtacggctgctaggactgtgcccaggg
tcatctctgcagctcgtcactcaatacttgcctctgggttccttgctggatcatgtgaga
caacaccggggggcactggggccacagttgctgctgaattggggagtacaaattgccaag
ggtatgtactaccttgaggagcatggtatggtgcataggaacctagctgcccgaaatgtg
ctacttaagtcacccagtcaggttcaggtggcagattttggggtggctgacctgctgccc
cctgatgataaacagctactacacagtgaggccaagactccaattaagtggatggccctc
gagagtatccactttgggaaatacacacaccagagtgacgtctggagctatggtgtgact
gtctgggagctgatgacctttggggcagagccctatgcagggctgcgattggctgaagta
ccagatctgctagagaagggggagcggttggcacagccccagatctgtaccattgatgtc
tacatggtcatggtcaagtgttggatgattgacgagaacattcgcccgacctttaaagaa
ctagccaatgagtttaccaggatggcccgagacccaccacggtatctagtcataaagaga
gagagtgggcctggaattccccctggggcagagccccctgctctgacaaacaaggaactg
gaggaagtagagctagagcctgaactagacctggacctggacttggaggcagaggaggac
aacttggtgacaacactaggctctgccctcagtctgccacttggaacacttaatcggcca
cgtgggagccagagctttttaagtccatcatctggatatatgcctatgaaccagaataat
cttggggaggcttgccaggagtctgcagtttgcggaggcagtgaactatgcccccgtcca
gcctctctgcacccattgccacggggacgcctggtatcagagtcatcggagggccatgtg
acaggctctgaggctgagctccaggaaaaagtgtcactgtgtagaagccggagccggagc
ccacggccacgtggagacagtgcctaccattcacagcgccacagcttgcttactcctgtc
actccagtctcctcaccagggttagaggaagaggatgttaatggttatgtcatgccagat
gcacatctcaaaggtactccctcctcccgggaaggcactctttcttctgtgggtctcaat
tctgtcctgggtaccgaagaagacgacgaagatgaggagtatgaatacatgaaccggagg
agaaggcacactccacctcgtccccctagacccggttccctcgaggagctgggttatgag
tacatggatgtgggatcagacctcagtgcttccctgggcagcacacagagttgcccactc
caccctgtgcccatcatgcccactgctggcacaactccagacgaggactatgaatatatg
aataagcgacgtggtggtggaggtcctgggggagattatgcagccatgggggcctgccca
gcagctgagcaagggtatgaagaaatgagagctttccaagggcctggacaccatgccccc
catgtccattatgcccgcctcaaaactctacgtagtttagaagccactgactctgccttt
gataaccccgattactggcacagcaggcttttccccaaggctaatgcccagagaacataa

DBGET integrated database retrieval system