KEGG   Pteropus alecto (black flying fox): 102895484
Entry
102895484         CDS       T02993                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein isoform X1
  KO
K05640  glial fibrillary acidic protein
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102895484 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102895484 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pale04812]
    102895484 (GFAP)
Membrane trafficking [BR:pale04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    102895484 (GFAP)
Cytoskeleton proteins [BR:pale04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     102895484 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head DUF1664 Spc7 DUF573 WD40_alt GAS
Other DBs
NCBI-GeneID: 102895484
NCBI-ProteinID: XP_006910202
UniProt: L5KRV9
LinkDB
Position
Unknown
AA seq 432 aa
MERRRVTSAARRSYVSSSEMVLGALTPSRRLGAGTRLSLARMPPPLPARVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLGTLRQKLQDETNLRLEAENNLATYRQEADEAT
LARLDLERKIESLEDEIRFLRKIHEEEMREIQEQLARQQVHVELDVAKPDLTAALREIRT
QYEAVASSNMHEAEEWYRSKFADLTDAAARNTELLRQAKHEANDYRRQLQALTCDLESLR
GTNESLERQMREQEERHAREVASYQEALARLEEEGQSLKDEMARHLQEYQDLLNIKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggagaggagacgggtcacctcagctgctcgccgctcctatgtttcgtcctcggagatg
gtgctgggggccctgactcctagccgccgcctgggtgctggcacccgcctttccttggct
cgaatgccgcccccactcccagcccgggtagacttctccctggctggggcactcaatgct
ggcttcaaggagacacgggccagtgagcgggcagagatgatggagctcaatgaccgcttt
gccagctacatcgagaaggtgcgcttcctggaacagcagaacaaggcactggctgctgag
ctgaaccaactgcgggccaaggagcccaccaagctggctgatgtctaccaggctgagctg
cgtgagctgcggctgcggctggatcaactcaccgccaacagcgcccggctcgaggtcgag
agggacaacctggcacaggacctgggcaccctgaggcagaagctccaagatgaaaccaac
ctgaggctggaggcagagaacaacctagccacctatcgacaggaagcagatgaagccacc
ctggcccgtctggatctggagagaaagattgagtctctggaagacgaaatccggttcctg
aggaagatccatgaggaggagatgcgcgagatccaggagcagctggcccggcagcaggtc
catgtggagctggatgtggccaagccagacctcacagcagccctgagagagatccgcaca
cagtatgaggcagtggcatccagcaacatgcacgaggcagaggagtggtaccgatccaag
tttgcggacctgacagacgccgctgcccgcaacaccgagctgctccgccaggccaagcac
gaggccaacgactacaggcgccagctgcaggccttgacctgtgacctggagtccttgcgt
ggcacgaacgagtctctggagaggcagatgcgagagcaggaggagcgccatgcgcgggag
gtggcgagttaccaggaggcgctggcccggctggaggaggaggggcagagcctcaaggat
gagatggcccgccacctgcaggagtaccaggacctgctcaacatcaagctggccctggac
atcgagatcgccacctacaggaagctgctggagggcgaggagaaccgcatcaccattcct
gtgcagaccttctccaacctgcagatccgagaaactagcctggacaccaagtccgtgtcg
gaaggccacctcaagaggaacatcgtggtgaagactgtggagatgcgcgatggagaggtc
attaaggagtccaagcaggagcacaaagacgtgatgtga

DBGET integrated database retrieval system