KEGG   Pteropus alecto (black flying fox): 102895516
Entry
102895516         CDS       T02993                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04151  PI3K-Akt signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  Jak-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04672  Intestinal immune network for IgA production
pale04940  Type I diabetes mellitus
pale05135  Yersinia infection
pale05142  Chagas disease (American trypanosomiasis)
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05320  Autoimmune thyroid disease
pale05321  Inflammatory bowel disease (IBD)
pale05330  Allograft rejection
pale05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    102895516 (IL2)
   04151 PI3K-Akt signaling pathway
    102895516 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102895516 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102895516 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102895516 (IL2)
   04660 T cell receptor signaling pathway
    102895516 (IL2)
   04658 Th1 and Th2 cell differentiation
    102895516 (IL2)
   04659 Th17 cell differentiation
    102895516 (IL2)
   04672 Intestinal immune network for IgA production
    102895516 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102895516 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102895516 (IL2)
   05321 Inflammatory bowel disease (IBD)
    102895516 (IL2)
   05330 Allograft rejection
    102895516 (IL2)
   05332 Graft-versus-host disease
    102895516 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102895516 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102895516 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102895516 (IL2)
   05162 Measles
    102895516 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    102895516 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102895516 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102895516 (IL2)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102895516 (IL2)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Haparin
  Cytokines
   102895516 (IL2)
SSDB
Motif
Pfam: IL2 MutS_III TIG_plexin AATF-Che1
Other DBs
NCBI-GeneID: 102895516
NCBI-ProteinID: XP_006917814
UniProt: L5K7D9
LinkDB
Position
Unknown
AA seq 152 aa
MHKMYFLSCIALTLALVADGAPTSSSRKETQQQLEHLLKDLQRLLETVNNYKNHELSSML
TFKFYMPNATELNHLQCLVDELKPLEEVLTIAQSKNSHSDIKESVSNINVTAQKLKGPET
KYTCVYNDESANVKEFLNKWITFCQSILSTLA
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcacaagatgtacttcttgtcttgcattgcactaactcttgcactggtggcagacggt
gcacctacttcaagctctaggaaggaaacacagcaacagctggagcatttgctgaaggac
ttacagcggcttttggagacagttaataattacaagaatcacgaactctccagcatgctc
acctttaaattttacatgcccaatgccacagaactgaatcatctgcagtgcctcgtggac
gaactcaaacctttggaggaagtgctaactatagctcaaagcaaaaactctcactcagac
atcaaggagtcagtgagcaatatcaacgtaacagctcagaaactaaagggacctgaaaca
aaatacacatgtgtctataatgatgagagcgcgaacgttaaagaatttctgaacaaatgg
attaccttttgtcaaagcatcctctcgacactggcttaa

DBGET integrated database retrieval system