KEGG   Pteropus alecto (black flying fox): 102895524
Entry
102895524         CDS       T02993                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04110  Cell cycle
pale04151  PI3K-Akt signaling pathway
pale04218  Cellular senescence
pale04310  Wnt signaling pathway
pale04350  TGF-beta signaling pathway
pale04390  Hippo signaling pathway
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04630  JAK-STAT signaling pathway
pale04919  Thyroid hormone signaling pathway
pale05132  Salmonella infection
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05205  Proteoglycans in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05213  Endometrial cancer
pale05216  Thyroid cancer
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05221  Acute myeloid leukemia
pale05222  Small cell lung cancer
pale05224  Breast cancer
pale05225  Hepatocellular carcinoma
pale05226  Gastric cancer
pale05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102895524 (MYC)
   04012 ErbB signaling pathway
    102895524 (MYC)
   04310 Wnt signaling pathway
    102895524 (MYC)
   04350 TGF-beta signaling pathway
    102895524 (MYC)
   04390 Hippo signaling pathway
    102895524 (MYC)
   04630 JAK-STAT signaling pathway
    102895524 (MYC)
   04151 PI3K-Akt signaling pathway
    102895524 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102895524 (MYC)
   04218 Cellular senescence
    102895524 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102895524 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102895524 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102895524 (MYC)
   05202 Transcriptional misregulation in cancer
    102895524 (MYC)
   05206 MicroRNAs in cancer
    102895524 (MYC)
   05205 Proteoglycans in cancer
    102895524 (MYC)
   05230 Central carbon metabolism in cancer
    102895524 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102895524 (MYC)
   05225 Hepatocellular carcinoma
    102895524 (MYC)
   05226 Gastric cancer
    102895524 (MYC)
   05216 Thyroid cancer
    102895524 (MYC)
   05221 Acute myeloid leukemia
    102895524 (MYC)
   05220 Chronic myeloid leukemia
    102895524 (MYC)
   05219 Bladder cancer
    102895524 (MYC)
   05213 Endometrial cancer
    102895524 (MYC)
   05224 Breast cancer
    102895524 (MYC)
   05222 Small cell lung cancer
    102895524 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102895524 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102895524 (MYC)
   05161 Hepatitis B
    102895524 (MYC)
   05160 Hepatitis C
    102895524 (MYC)
   05163 Human cytomegalovirus infection
    102895524 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102895524 (MYC)
   05169 Epstein-Barr virus infection
    102895524 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102895524 (MYC)
   03019 Messenger RNA biogenesis [BR:pale03019]
    102895524 (MYC)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    102895524 (MYC)
Messenger RNA biogenesis [BR:pale03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102895524 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 102895524
NCBI-ProteinID: XP_006919905
UniProt: L5K5M7
LinkDB
Position
Unknown
AA seq 440 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAAFASFSPRDDDDGGGGSFSSADQLEMVTELLGGDMVNQSFICDP
DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDGGSRSPARGHSACSTSSLYLQ
DLSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAASSPRASPEPLV
LHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGSHSKPPHSPLVLKR
CHVSTHQHNYAAPPSTRKDYPPTKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTH
NVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILAIQAEEQKLISEKDL
LRKRREQLKHKLEQLRNSCA
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaggaattacgacctcgactacgactcggtgcag
ccctatttctactgcgacgaggaggagaacttctaccaccaacagcagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcgccgagccggcgctccgggctctgctcgccctcctacgttgctgcgttcgcgtcc
ttctcccccagggacgatgacgacggcggcggcggcagcttttcgtcggccgaccagctg
gagatggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgacccg
gacgacgagaccttcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcg
gccgccgccaagctcgtctccgagaagctggcctcctaccaggctgcgcgcaaagacggc
ggcagccggagccccgcccgcgggcacagcgcctgctccacctccagcctgtacctgcag
gacctgagcgccgccgcctccgagtgcatcgacccctccgtggtcttcccctacccgctc
aacgacagcagctcgccgaagccctgcgcctccccggactccaccgccttctccccgtcc
tcggactctctgctctcctcggccgcgtcctccccgcgggccagccccgagcccctggtg
ctccacgaggagacaccgcccaccaccagcagcgactctgaggaagaacaagaggatgag
gaagaaatcgatgttgtttctgtggaaaagaggcagccccctgccaaaaggtcagaatcg
gggtcaccctctgctggaagtcacagcaaacctcctcacagcccactggtccttaagcgg
tgccacgtgtccacccatcagcacaattacgcagcacccccttccaccaggaaagactat
ccccccaccaagagggctaagttggacagtggccgagtcctgaaacagatcagcaacaac
cgcaaatgtgccagccccaggtcctcagacacagaggagaatgacaagaggcgaacacac
aacgttctggaacgccagaggagaaacgagctgaaacgcagctttttcgccctgcgtgac
cagatcccggagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagcc
accgcatacatcctggccatccaagcagaggagcaaaagctcatttcagaaaaagactta
ttgcggaagcgacgagaacagttgaaacacaaacttgaacagctacggaactcttgtgca
tga

DBGET integrated database retrieval system