KEGG   Pteropus alecto (black flying fox): 102895542
Entry
102895542         CDS       T02993                                 

Gene name
ESPL1
Definition
(RefSeq) separin isoform X1
  KO
K02365  separase [EC:3.4.22.49]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale04114  Oocyte meiosis
pale05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102895542 (ESPL1)
   04114 Oocyte meiosis
    102895542 (ESPL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102895542 (ESPL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pale01002]
    102895542 (ESPL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pale03036]
    102895542 (ESPL1)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     102895542 (ESPL1)
Peptidases and inhibitors [BR:pale01002]
 Cysteine peptidases
  Family C50: separase family
   102895542 (ESPL1)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    102895542 (ESPL1)
SSDB
Motif
Pfam: Peptidase_C50 CHAT
Other DBs
NCBI-GeneID: 102895542
NCBI-ProteinID: XP_006904594
LinkDB
Position
Unknown
AA seq 2118 aa
MQASALGAMRNFKGVNFGTLLSNPKEAEELLPDLKEFLSKLPAGSSSCRFDAERRQACDT
ILRACNQQLTAKLACRRHLGSLLELAELACDGYLASNPQCPPLYLERILFIFLRNVAAQG
IPEATLRLARPLHACLVQCSPQAAPQDYEAVARGSFSLLWKGAEGLVEQRAAYSTRLKAL
SFLVLLEDESTPCEVPHFASPTACRVVAAHQLFDASGHGLNEADADFLDDQLSRHVIRAL
VGEGGDSPGLSPQKALCLLELTVEHCRRLCWSRLYTKATRAVEKAQDYLRKTNLAPSLQL
CQLGIKLLQVQEGGPHAVAKLLIKASALLNSSMEAPLPPLRALYDSCQFFLSGLERGTKR
RYGPDAIRGLFAFLGGYYTLIQQLQDGVFADSSKQHQSLVQMHFQGLHLYTVVVYDFAQG
CQVADLADLAQLVESCKSTVVWMLEALQGLSGRELTDYLGMTASYTSNLAYSFYSHKLYA
EACAISEPLCQHLGLVKPGTHPEVPPEKLHRCFRLHVESLKKLGKQAQGCKMVTLWLAAL
QPCDPKYMAEPVTFWVRVKIDAARAGDKELQLRTLRDNLSSWDPETLALLLREELQAYKA
VRADTGQERFNVICDLLELTPEETPAGAWARATHLVELAQVLCYHDFAQQTDCSALDAIR
EALQLLESVKPEAQAEDQLLDDKAQALLWLYICTLETKMREGIERDRKAQAPSNLEEFEV
NDLNYEDKLQEDRFLYSNIAFNLAADAALSKCLDQALALWKEVLTKEQTPALRCLQQTAA
SLQILAALYQLVAKPLQALDVLLLVRIISQRLEDHAKAAGSSCHVTQLLLTLGCPSYAQL
HLEEAESTLKFVDHTTDTYLLLSLTCDLLRSQLCYAYHKVTEGASLLLSVLQDPALQRSS
KAWYLLRVQALQLVAVYLSLSSDSLSASLWEQLCAQGWQTPEIALIDSHKLLRSIILLLM
GSDVLSIQKAAVETPFLDYGENLVQKWQVLAEVLSCSEKLVSRLGYLGSVSEAKAFCLEA
LKLTTKLQIPRQCALFLVLKGELELARNDIDLCQSDLRQVLFLLESCTEFCGLAQHPDSV
KKVHLQKGQQQAQVPHPPELPEEEVFLRGPVLELVATVAKEPGPIAPSTNSSPILKTKPQ
PSPGFLTHLPTCDCSLCASPVLSAVCLRWVLVTAGVRLAMGHQAQSLDLLQVVLKGCPAA
TERLTQALQASLNHKAPPSSIPSLFDEILAQAYTQLAQEGLNESSNKNLEKVLESGLKFV
AARIPYLEPWRANLLLIQALAKLAGHSCCTTQLFASSWGWQQPSVKTPPGSEPSKLRSQK
HSGRGRQQVVSATLPLHNTSRKGLKGLEGGGPPCTPKPSGRLRLASPRVPFTVFEDASPT
QNKPEIPKAPRVQQRVQTRLKVNFSDDSDLEDPVEARLSEGPKRRGIASRGRGRGQTRKG
PSLKTDTVAVPGSAPEPSGLSGRSRRAKKVVSRHCEELGPEIMRTIPEELLTDDQMEMSF
EILRGSDGKDSASGGKTSAPERDTAIGECEVLRRDSSKLELPLLCPDKEKDKDLGPRLRC
RSASVAIGVSNLDSIRDSLSVAFRGISHCPPSGLYAHLCRLLALCLGHQDPYATAYLVTE
SVSITCRHQLLTHLHRQLSKVQKHRGSLEIADQLQDLSLQEKPGDLPLARIQSLFSFRTS
GSGHFPQPEKESFQEHLALIPSGVTVCVLALATLQPRTVGNTLLLTRLEKDNPPVTVQIP
TAQNKFPLSSALKEFDAIQKEQKENSSCTDKREWWTGRLELDHRMEVLITSLEKHVLGCW
RGLLLPSSEDPGPAQEASHLQELLQECGWKYPDSTLLKIMLSGANTLTPQDIQTLAYGLC
PAQPERAQELLSEAIGRLQGQTALSNRHLVLVLDKDLQKLPWESIPSLRALPVTRLPSFR
FLLSYTSIKESGASSVLSQGVDPHSTFYVLNPHNNLSSTEEQFRANFSSEAGWKGVIGEV
PSPEQVQAALTEHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVHGNLEG
AGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPLLYYVSQARQAPRL
KYLIGAAPVAYGLPVSLR
NT seq 6357 nt   +upstreamnt  +downstreamnt
atgcaggcctccgccctcggcgccatgaggaacttcaaaggagtcaactttggtactctg
ctaagcaacccgaaggaggctgaagagttgttgcctgacttgaaggaattcctgtccaag
cttccagctggttcttccagctgccgatttgatgctgagaggagacaagcttgtgatacc
atcctgagggcttgcaaccagcagctgactgccaagctggcttgccgtaggcacctaggg
agcctgctggagctggcagaactggcttgcgatggctacttggcatccaacccccagtgc
ccacccctctacctggaacgaattctcttcatctttctgcggaatgttgctgcacaggga
atcccagaggccacactccgacttgctcggccccttcatgcctgcttggtgcagtgttct
ccccaagctgctccccaggactatgaggctgtggctcggggcagcttttctctgctttgg
aagggggcagaaggtctggtggagcagcgagctgcatactcaactcgactgaaggccttg
agctttctagtactcttggaggatgaaagtaccccttgtgaggttccccattttgcttct
ccaacagcttgtcgagtggtagctgcccatcagctctttgatgccagtgggcatggtctg
aatgaagcagatgctgatttcctagatgaccaactctccaggcatgtgatcagagccttg
gtaggtgagggaggagactctcctggtctctctccccagaaggccctctgtctcttggaa
ctcaccgtggaacattgccgtcgcctctgctggagccgcctctacaccaaggccaccagg
gcagtagagaaagcccaagattacctaaggaaaaccaatctggcccccagcctccagctg
tgccagctggggattaaattgctgcaggtccaggaaggaggaccccacgcagtggccaag
cttctaatcaaggcatcagctctcctgaacagcagtatggaggcaccattgcccccactg
cgggcattgtatgacagctgccagttcttcctctcaggcctggagcggggcaccaagagg
cgctatggacctgatgctattcggggcctctttgcttttcttggcgggtactacaccctc
attcagcagctacaggatggtgtctttgcggactcctccaagcagcaccagtctttggtt
cagatgcattttcagggacttcacctctacactgtggtggtttatgactttgcccaaggc
tgtcaggtagctgatttggctgacttagcccagctggtggaaagttgcaaatctactgtt
gtctggatgctggaggccttacagggcctgtcaggccgagagctgactgactacctgggg
atgactgcctcttacaccagtaacttggcctacagtttctatagtcacaagctctatgcc
gaggcctgtgccatctctgagcccctctgtcagcacctgggcttggtgaagccaggcacc
catcctgaggtgcctcctgagaagttacacaggtgcttccggctgcatgtagagagttta
aagaaactgggtaaacaggcacagggctgcaagatggtgactttgtggctggcagcgctg
cagccctgtgaccccaaatacatggctgagccagtcaccttctgggtccgggtcaagata
gatgctgccagagctggagacaaggaactacagctgaggactctgcgagacaacctgagc
agctgggacccagagaccctggccctcctgctcagggaagagctgcaggcctacaaggca
gtgcgggccgatacagggcaggaacggttcaacgtcatctgtgacctgctggagctgacc
cctgaggagacaccagccggggcctgggctcgagccacccacttggtggaactggctcag
gtgctctgctaccatgactttgcccagcagactgactgctctgccctggatgctatccgg
gaagccttgcagcttctggagtctgtgaagcctgaggctcaggctgaggatcagctcctg
gatgataaagcacaagccctgctgtggctttacatctgtaccctggagaccaaaatgcgg
gaaggtatcgagcgggatcggaaagcccaggcccctagtaacctggaggaatttgaagtc
aatgacctgaactatgaagataaactccaggaagatcgtttcctatacagtaacattgcc
ttcaatctggctgcagatgctgctctgtccaaatgcctggaccaagccctggccctgtgg
aaggaggtgcttacaaaggagcagactcctgctttgcggtgtctccagcagacagcagcc
tcactgcagatcctagcagccctctatcagctggtggcaaagcccctgcaggctctggat
gtcctcctgcttgtacggattatctcccagagactggaggaccacgcaaaggcagctggc
tcctcctgccatgtcacccagctcctcctgacactcggctgtcccagctatgcccagtta
cacctggaagaggcagaatcaactctgaagtttgtggatcataccactgacacctacctg
ctcctttccttgacctgtgacctactgagaagtcaactctgctatgcttaccacaaggtg
acggagggtgcctctctgttgctgtctgtgcttcaggaccctgccctccagaggtcatcc
aaggcctggtacttgctgcgtgtccaggctctgcagctggtggcagtctaccttagcctc
tcatcagatagcctctcagcctccctgtgggagcagctctgtgctcaaggctggcagaca
cctgaaatagcactcattgactcccataagctcctccgaagcatcattctcctgctcatg
ggcagcgatgtgctctcaattcaaaaagcagctgtggagacaccttttctggattatggt
gaaaatctggtacaaaaatggcaggtgcttgcagaggtgctaagctgctcagagaagctg
gtctcccgtctgggctacttaggtagtgtgagcgaagccaaggccttttgcttggaggcc
ctgaaacttacaacaaagttgcagataccacgccagtgtgccctgttcctggtgctgaag
ggggagctggagctggcacgcaatgatatcgacctctgtcagtcagacctgagacaggtt
ctcttcttgcttgagtcttgcacggagttttgtggactagcccagcacccggactctgtg
aagaaggtccacttgcagaaggggcagcagcaagcccaagtcccccatcctccagagctc
ccagaggaggaagtcttcctaagaggccctgttctggagctggtggccactgtggccaag
gagcctggccccatagcgccttctactaactcctccccaatcctgaaaacaaagccccag
cccagccctggcttcctgacccatttgcccacctgtgactgctcgctctgtgccagccct
gtcctctcagcagtctgtctacgatgggtgttggtcacagcgggggtgagactggccatg
ggccatcaggctcagagtctggatcttttgcaagtcgtgctaaagggttgccctgcagcc
actgagcgcctcacccaagctctacaggcttccctgaatcacaaagcacccccctcctcg
atcccgagcctctttgatgagatcttggctcaggcatacacacaactggcacaggagggg
ctgaatgagtcatcaaacaagaacctggagaaggtcctggagtcagggctaaagtttgta
gcagcacggataccctacctggagccctggcgagccaacctgctcttgattcaggccctt
gcaaagctggctggacacagctgctgcactacccaactttttgcaagctcctggggctgg
cagcagccatcagtaaagaccccaccaggctcagagccctctaagcttcggagccaaaaa
cattctggacgagggcgccagcaggtggtctctgctaccctgccccttcataatacctct
cggaaaggtctgaaaggtctggaaggtggaggaccaccctgtacacctaagccctcaggc
aggcttaggctggccagccctcgtgtccctttcactgtgtttgaggatgcctctcctaca
cagaacaagcctgaaattcccaaggcccccagggtacaacagagggtccagacccgcctg
aaggtgaactttagtgatgacagtgacttggaagacccagttgaggcacggctttcagag
gggcccaagagacggggtattgcttcccggggccgaggccggggccagactaggaagggc
ccgagcttgaagactgatacagtggctgtcccaggtagtgcccctgagccctctggcctc
agtggcaggagccggagggccaagaaggttgtgtcaagacattgtgaggagctgggtccc
gagattatgaggaccatccctgaggagttgctgactgacgaccagatggaaatgagcttt
gagatcctcaggggctctgatgggaaagactcagcctcaggtgggaagacatcagctcca
gagcgtgacacagccataggagaatgtgaggtgttgagacgggattccagcaaattggag
ctgcccctcctgtgcccagataaagagaaagacaaggatcttggtcctcggctccgatgc
cgttcagcctctgtagccattggtgtctctaacctggattccatccgtgactcactgagt
gttgctttccgtgggatcagtcactgccctcctagtgggctctatgctcacctctgccgc
ctcctggccttgtgcctgggccaccaggatccctatgccactgcctacctcgtcactgaa
tctgtctccatcacctgtcgccaccagctgctcacccatctccacaggcagctcagcaag
gtccagaagcaccgaggatcacttgaaattgcagaccagctgcaagacctgagtctccag
gagaagcctggagatctccccctggcccgtatccagagtctcttttccttcaggacttca
ggatctggccatttcccccagcctgagaaggagagtttccaggagcacctggctctgatc
cccagtggggtgactgtgtgtgtgttggccctggccaccctccagcctcgaacggtgggc
aacaccctcctgctgacccggctggaaaaagacaatcccccggtcactgtgcagatcccc
actgcccagaacaagtttcctctgagttcagccctgaaagagtttgatgccatccagaag
gaacagaaagagaacagcagctgtactgacaaacgagaatggtggacagggcggctagaa
ctggaccataggatggaggttctcatcacttccctggagaagcatgtgttgggctgctgg
agggggctgttgctgccatccagtgaggaccctggccctgctcaagaggcctcccaccta
caagagttgctacaggaatgtggctggaaatatcccgactccactctgctgaaaatcatg
ctcagtggtgccaataccctcactcctcaggacattcagactctggcctatggactgtgc
ccagcccagccagagcgagcccaagagctcctgagtgaggcaataggacgtctacagggg
cagacagcactaagcaataggcatcttgtcttagtgctggacaaggacctgcaaaagctg
ccatgggagagcatacccagcctccgggcactgcctgtcactcgactgccctccttccgc
ttcctactcagctacaccagcatcaaagagtctggggcctcatcagtgctgagccaaggg
gtggatccacatagtaccttctatgttctgaaccctcacaataacctgtcaagcacagag
gagcaatttcgagccaattttagcagtgaagctggctggaaaggagtgattggggaggtg
ccgagcccagaacaggtgcaggcagccctgacggagcatgacttatatatctatgcaggg
catggggccggtgctcgcttcctggatgggcaggctgtcctgcggctgagctgccgggca
gtggccctgctgtttggctgcagcagtgcagctctggctgtgcatggaaacctggagggg
gctggcatcgtactcaagtatatcatggctggctgtcccctgtttctgggtaacctctgg
gatgtgactgaccgtgacatcgaccgctacacagaggcgctgctgcagggctggcttgga
gcaggcccaggagccccccttctctactatgtcagccaggcccgccaggctcctcgactc
aagtatctcatcggggcagcacctgtagcctatggcttgcctgtctccctgcggtga

DBGET integrated database retrieval system