KEGG   Pteropus alecto (black flying fox): 102895746
Entry
102895746         CDS       T02993                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01523  Antifolate resistance
pale04060  Cytokine-cytokine receptor interaction
pale04061  Viral protein interaction with cytokine and cytokine receptor
pale04066  HIF-1 signaling pathway
pale04068  FoxO signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04218  Cellular senescence
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04623  Cytosolic DNA-sensing pathway
pale04625  C-type lectin receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04657  IL-17 signaling pathway
pale04659  Th17 cell differentiation
pale04668  TNF signaling pathway
pale04672  Intestinal immune network for IgA production
pale04931  Insulin resistance
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05010  Alzheimer disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05133  Pertussis
pale05134  Legionellosis
pale05135  Yersinia infection
pale05142  Chagas disease
pale05143  African trypanosomiasis
pale05144  Malaria
pale05146  Amoebiasis
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05162  Measles
pale05163  Human cytomegalovirus infection
pale05164  Influenza A
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05321  Inflammatory bowel disease
pale05323  Rheumatoid arthritis
pale05332  Graft-versus-host disease
pale05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102895746 (IL6)
   04668 TNF signaling pathway
    102895746 (IL6)
   04066 HIF-1 signaling pathway
    102895746 (IL6)
   04068 FoxO signaling pathway
    102895746 (IL6)
   04151 PI3K-Akt signaling pathway
    102895746 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102895746 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102895746 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102895746 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102895746 (IL6)
   04620 Toll-like receptor signaling pathway
    102895746 (IL6)
   04621 NOD-like receptor signaling pathway
    102895746 (IL6)
   04623 Cytosolic DNA-sensing pathway
    102895746 (IL6)
   04625 C-type lectin receptor signaling pathway
    102895746 (IL6)
   04659 Th17 cell differentiation
    102895746 (IL6)
   04657 IL-17 signaling pathway
    102895746 (IL6)
   04672 Intestinal immune network for IgA production
    102895746 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102895746 (IL6)
   05202 Transcriptional misregulation in cancer
    102895746 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102895746 (IL6)
   05321 Inflammatory bowel disease
    102895746 (IL6)
   05332 Graft-versus-host disease
    102895746 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102895746 (IL6)
   05020 Prion disease
    102895746 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    102895746 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102895746 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102895746 (IL6)
   04931 Insulin resistance
    102895746 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102895746 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102895746 (IL6)
   05135 Yersinia infection
    102895746 (IL6)
   05133 Pertussis
    102895746 (IL6)
   05134 Legionellosis
    102895746 (IL6)
   05152 Tuberculosis
    102895746 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102895746 (IL6)
   05161 Hepatitis B
    102895746 (IL6)
   05171 Coronavirus disease - COVID-19
    102895746 (IL6)
   05164 Influenza A
    102895746 (IL6)
   05162 Measles
    102895746 (IL6)
   05168 Herpes simplex virus 1 infection
    102895746 (IL6)
   05163 Human cytomegalovirus infection
    102895746 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102895746 (IL6)
   05169 Epstein-Barr virus infection
    102895746 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102895746 (IL6)
   05144 Malaria
    102895746 (IL6)
   05142 Chagas disease
    102895746 (IL6)
   05143 African trypanosomiasis
    102895746 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102895746 (IL6)
   01523 Antifolate resistance
    102895746 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102895746 (IL6)
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102895746 (IL6)
SSDB
Motif
Pfam: IL6 IL11 DUF4924 GCSF IL23 Phage_int_SAM_1
Other DBs
NCBI-GeneID: 102895746
NCBI-ProteinID: XP_006912045
LinkDB
Position
Unknown
AA seq 209 aa
MNSFCTSAFRPVAFSLGLLLVMATALPIPVPSGEDSKDDTNSNRPQLTSPNQTENLIKSI
FLEISEVRNKMCGNDDSCKNSKEVLTENNLNLPKMAEKDGCFQSGFNQETCLMKITTGLL
EFQIYLDYLQNKFEENAKAMQMRTKALVQVLKQKVKNPNEITTPDPTTNSSLLAKLQSQS
EWLQTTTIHLILRSLEDFLQFTQRAVRIM
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaactccttctgcacaagcgctttcaggccagtcgccttctccctggggctgctgcta
gtgatggctactgctctccctattccggttccctccggagaagattccaaagatgatacc
aactcaaacagaccacaactcacctctccaaaccaaaccgaaaacctcattaagtccatc
ttccttgaaatctctgaagtgagaaataagatgtgtggcaacgatgactcatgtaaaaac
agcaaggaggtactgacagaaaacaacctgaaccttccaaaaatggcagaaaaagatgga
tgcttccagtcggggttcaatcaggagacctgcttgatgaaaatcactaccggtctcctg
gagtttcagatatacctggactacctccagaacaagtttgaggaaaacgccaaggcgatg
cagatgcgaaccaaagccctggtccaggtgctgaagcagaaggtaaagaatccaaatgag
ataaccacccctgacccaaccacaaactccagcctgctggctaagctgcagtcgcagagc
gaatggctgcagaccacgacaattcacctcatcctgcgaagccttgaggatttcctgcag
ttcactcagagggctgtccggataatgtag

DBGET integrated database retrieval system