KEGG   Pteropus alecto (black flying fox): 102896121
Entry
102896121         CDS       T02993                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale04010  MAPK signaling pathway
pale04012  ErbB signaling pathway
pale04024  cAMP signaling pathway
pale04137  Mitophagy - animal
pale04210  Apoptosis
pale04310  Wnt signaling pathway
pale04380  Osteoclast differentiation
pale04510  Focal adhesion
pale04530  Tight junction
pale04620  Toll-like receptor signaling pathway
pale04621  NOD-like receptor signaling pathway
pale04625  C-type lectin receptor signaling pathway
pale04657  IL-17 signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale04660  T cell receptor signaling pathway
pale04662  B cell receptor signaling pathway
pale04668  TNF signaling pathway
pale04722  Neurotrophin signaling pathway
pale04912  GnRH signaling pathway
pale04915  Estrogen signaling pathway
pale04921  Oxytocin signaling pathway
pale04926  Relaxin signaling pathway
pale04932  Non-alcoholic fatty liver disease
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05132  Salmonella infection
pale05133  Pertussis
pale05135  Yersinia infection
pale05140  Leishmaniasis
pale05142  Chagas disease
pale05161  Hepatitis B
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05167  Kaposi sarcoma-associated herpesvirus infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05171  Coronavirus disease - COVID-19
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05210  Colorectal cancer
pale05211  Renal cell carcinoma
pale05224  Breast cancer
pale05231  Choline metabolism in cancer
pale05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pale05321  Inflammatory bowel disease
pale05323  Rheumatoid arthritis
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102896121 (JUN)
   04012 ErbB signaling pathway
    102896121 (JUN)
   04310 Wnt signaling pathway
    102896121 (JUN)
   04668 TNF signaling pathway
    102896121 (JUN)
   04024 cAMP signaling pathway
    102896121 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102896121 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    102896121 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102896121 (JUN)
   04530 Tight junction
    102896121 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102896121 (JUN)
   04621 NOD-like receptor signaling pathway
    102896121 (JUN)
   04625 C-type lectin receptor signaling pathway
    102896121 (JUN)
   04660 T cell receptor signaling pathway
    102896121 (JUN)
   04658 Th1 and Th2 cell differentiation
    102896121 (JUN)
   04659 Th17 cell differentiation
    102896121 (JUN)
   04657 IL-17 signaling pathway
    102896121 (JUN)
   04662 B cell receptor signaling pathway
    102896121 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102896121 (JUN)
   04915 Estrogen signaling pathway
    102896121 (JUN)
   04921 Oxytocin signaling pathway
    102896121 (JUN)
   04926 Relaxin signaling pathway
    102896121 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102896121 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102896121 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102896121 (JUN)
   05203 Viral carcinogenesis
    102896121 (JUN)
   05231 Choline metabolism in cancer
    102896121 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102896121 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102896121 (JUN)
   05211 Renal cell carcinoma
    102896121 (JUN)
   05224 Breast cancer
    102896121 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102896121 (JUN)
   05321 Inflammatory bowel disease
    102896121 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    102896121 (JUN)
   05031 Amphetamine addiction
    102896121 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102896121 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102896121 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102896121 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102896121 (JUN)
   05135 Yersinia infection
    102896121 (JUN)
   05133 Pertussis
    102896121 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102896121 (JUN)
   05170 Human immunodeficiency virus 1 infection
    102896121 (JUN)
   05161 Hepatitis B
    102896121 (JUN)
   05171 Coronavirus disease - COVID-19
    102896121 (JUN)
   05162 Measles
    102896121 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102896121 (JUN)
   05169 Epstein-Barr virus infection
    102896121 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102896121 (JUN)
   05142 Chagas disease
    102896121 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102896121 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102896121 (JUN)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    102896121 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 TFIIA FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N TMF_DNA_bd
Other DBs
NCBI-GeneID: 102896121
NCBI-ProteinID: XP_006919320
UniProt: L5K6T4
LinkDB
Position
Unknown
AA seq 334 aa
MTAKMETTFYDDALNVSFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNADL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSSGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgcccttaacgtctcgttcctccaa
tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggtagcctgaagccacacctccgggccaagaacgcggacctc
ctcacctcgcccgatgtgggactgctcaaactggcgtcgccagagctggagcgcctaata
atccagtccagcaacgggcacatcaccaccacgccgacccctacccagttcctgtgcccc
aagaacgtgacggacgagcaggagggcttcgctgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctacccagcgtcacgtccgcggcgcagccggtcagcggggct
ggcatggtggctcccgcagtggcttccgtggcgggcggcagcggcagcagcggcttcagt
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcag
ccccagcagcagcaacagccaccgcagcctccgcaccacctgccccagcagatccccgtg
cagcacccgcggctgcaagccctgaaggaggagccgcagacggtacccgagatgcccggg
gaaacgccgcccctgtcgcctatcgacatggagtcccaagagcggatcaaggcggagagg
aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatc
gccaggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system