KEGG   Pteropus alecto (black flying fox): 102896329Help
Entry
102896329         CDS       T02993                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale03410  Base excision repair
Module
pale_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:pale00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    102896329 (LIG3)
Enzymes [BR:pale01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102896329 (LIG3)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     102896329 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M LIG3_BRCT DNA_ligase_A_N zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase mRNA_cap_enzyme Synaptonemal_3 HD_2
Motif
Other DBs
NCBI-GeneID: 102896329
NCBI-ProteinID: XP_015454825
LinkDB All DBs
Position
Un
AA seq 1015 aa AA seqDB search
MTLAFKILFPSTLRALSRKELCLFREEHLWPNIKHFSQWSETDRLHGPCLLRKRKPVLSF
QEGSLRLRATCLVLLPGSHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRI
GKVVPNPFSESGGDMKEWYHIKCIFEKLERARATTKKIEDLTELEGWEELEDNEKEQINQ
HITDLSSKTASTPKKKAVVQAKLTATGQVTSPVKGASFVTSTNTRKFSGFSAMPNNSGEA
RSSPTPRRSLSSSKCDPKHKDCLLRVFRKLCATVAENPSYNMKTQIIQDFLRKGSAGDGF
HGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFE
QSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIISNKVKD
SVFYFHAPVHIGRLDALDPNAYEAFKASRNLQDVVERVLHNEQEVEKEPGQRRSLSVQAS
LMTPVQPMLAEACKSIEYAIRKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPH
KVAHFKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFD
CIYFNDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKQVTKVSDLVDMINRVIREGLEG
LVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCY
DPSSQKWCTVTKCSGGHDDATLARLQKELDMVKISKDPSKIPSWLKINKIYYPDFIVPDP
KKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRHDKDWKSATNLPKLKELYQLSKERA
DFTVVAGDEGSSTTGGSSGENEGTSKPSVSRKTRTSPKHPSASAKKAEGNLSSPNSKGGH
KLTAKPSPVKVGEKLVTKSSVKVGVKRKAPDETPCQAKVLLDIFTGVRLYLPPSTPDFSR
LRRYFVAFNGDLVQEFDMASATHVLGSRDKNLEAQQVSSEWIWACIRKRRLVAPC
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atgactttggctttcaagattctcttcccatcaaccctccgtgcactcagccgaaaagaa
ttgtgcctattccgagaagaacatctttggccaaacataaaacatttcagccagtggtca
gaaacagatcggcttcatgggccctgcctactccggaaaagaaagcctgttctgtcattc
caggaaggcagtctaagactacgtgccacctgccttgtcttattgccagggtcgcatgtg
ggactctgcagtgggccctgtgagatggctgagcaacggttctgtgttgactatgccaag
cgtggcacagccggctgcaaaaaatgcaaggaaaagattgtaaagggtgtgtgccgaatc
ggcaaagtggtacctaatcctttctcagagtccgggggtgatatgaaagagtggtaccac
attaaatgcatatttgagaaactggagcgggcccgggccaccacaaaaaaaatcgaggac
ctcacagagctggaaggctgggaagagctggaagataatgagaaagaacagataaaccag
cacattacagatctatcttctaagacagcaagcacaccaaagaagaaagctgttgtccag
gctaagctgacagctactggccaggtgacatctccagtgaaaggtgcctcatttgttacc
agtaccaatacccggaaattttctggcttttcagccatgcccaacaactctggggaagcc
cgctcaagccctacccctagaagaagtctttcctcaagcaaatgtgaccctaagcacaag
gattgtctgctacgtgtgtttcggaagttgtgtgccacagtggctgaaaatcctagctac
aacatgaagactcagatcatccaggacttccttcggaaaggctcagcaggagatggtttc
cacggtgatgtgtacctaacagtgaagctgcttctaccaggtgttattaagagtgtttac
aacttgaatgataagcagatcgtgaagctttttagccgcatttttaactgcaacccagat
gatatggcacgggacctagagcagggtgacgtgtcagagacgatcagagtcttctttgag
cagagcaagtctttccccccagctgccaagagcctcctcaccatccaggaggtggacgaa
ttcctcctgcggctctccaagctcaccaaggaggatgagcaacaacaggccctgcaggac
atcgcctccaggtgtacagccaatgacctcaagtgcatcatcagcaataaggtcaaagac
agtgttttttatttccatgctcctgttcacattggcaggttagacgcccttgaccccaat
gcctatgaagccttcaaagcctcgcgcaacctgcaggatgtggttgagcgggtccttcac
aatgagcaggaggtggagaaggagccaggccagagacgatctctaagtgtgcaggcctca
ctgatgaccccagtgcagcccatgctggccgaggcctgcaagtccatagagtatgcgata
aggaagtgtcctaatggcatgttctctgagatcaagtatgatggggagcgagtccaggtg
cataagaatggggaccacttcagctacttcagccgcagtctcaagcctgtattacctcac
aaggtggcccactttaaggactacatcccccaggctttccctgggggccacagcatgatc
ttggattctgaggtgctcctgattgacaacaagacaggcaaaccactgccttttgggact
ttgggagtgcacaagaaagctgccttccaggatgctaatgtctgcctgtttgttttcgat
tgtatctacttcaatgatgtcagtttgatggacaggcctctgtgtgagcggcggaagttt
cttcatgataatatggttgaaattcccaatcggatcatgttctcagaaatgaagcaagtg
acgaaagtctcagacttggttgacatgataaaccgggtgatcagagagggattggaaggg
ctggtgctgaaagacgtgaagggtacatatgagcctggaaagcggcattggctgaaagtg
aagaaagactatttgaatgagggggcaatggctgacacagctgacctggtggtccttggg
gccttctatgggcaagggagcaaaggtggcatgatgtccatcttcctcatgggctgctac
gatccaagcagccagaagtggtgcacagtcaccaagtgttcaggtggccatgatgatgca
acactggcccgcctgcagaaggagctggacatggtgaaaatcagcaaggatcccagcaag
atacctagctggctgaaaatcaacaagatctactatcctgactttatcgtcccagaccca
aagaaagctgccgtgtgggagatcacaggagctgaattctccaaatctgaggctcacaca
gctgatgggatctccatccgattccctcgctgcacccgaatccgtcatgataaggattgg
aaatctgccactaacctccccaagctcaaggaactgtaccagctatccaaggagagggca
gacttcaccgtggtggctggagatgaggggagctccactacagggggcagcagcggagag
aatgagggcacctcaaagccttctgtgtctcgcaaaaccagaacctcccccaagcatcct
tctgccagtgccaagaaggcagaaggaaatctgagtagccctaacagcaaaggtggccac
aagctgactgcaaagccttctcctgtgaaggtgggagagaagctggtcacaaagtcttct
gtgaaagttggggtgaagcggaaggctcctgatgagaccccatgccaagcaaaggtgcta
ctagacatcttcactggggtgcggctctacctgccgccctccacaccagacttcagccgt
ctcagacgctacttcgtggcattcaatggggacttggtacaggaatttgacatggcctca
gctacacatgtgctgggtagcagggacaagaaccttgaggcccaacaggtctcctccgag
tggatttgggcatgtatccggaaacggagactggtagctccctgctag

DBGET integrated database retrieval system