KEGG   Pteropus alecto (black flying fox): 102896422
Entry
102896422         CDS       T02993                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cyclin-dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04110  Cell cycle
pale04115  p53 signaling pathway
pale04218  Cellular senescence
pale04934  Cushing syndrome
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05206  MicroRNAs in cancer
pale05212  Pancreatic cancer
pale05214  Glioma
pale05218  Melanoma
pale05219  Bladder cancer
pale05220  Chronic myeloid leukemia
pale05223  Non-small cell lung cancer
pale05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102896422
   04115 p53 signaling pathway
    102896422
   04218 Cellular senescence
    102896422
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102896422
   05206 MicroRNAs in cancer
    102896422
   05203 Viral carcinogenesis
    102896422
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102896422
   05225 Hepatocellular carcinoma
    102896422
   05214 Glioma
    102896422
   05220 Chronic myeloid leukemia
    102896422
   05218 Melanoma
    102896422
   05219 Bladder cancer
    102896422
   05223 Non-small cell lung cancer
    102896422
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102896422
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102896422
   05163 Human cytomegalovirus infection
    102896422
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102896422
   01522 Endocrine resistance
    102896422
SSDB
Motif
Pfam: Ank_5 Ank Ank_4 Ank_2
Other DBs
NCBI-GeneID: 102896422
NCBI-ProteinID: XP_024900056
LinkDB
Position
Unknown
AA seq 233 aa
MEPSADWLSAAAARGRADEVRALLEEGAPPNARNSHGRSPIQVMMMGSARVAELLLLHGA
DPNCADPATLTRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERGHREVAGYLRAA
SGGREGGSHAGTDAAEGPTVGCAAALSLPSAWRARSAEAVGEPRTASRTVDACGISEARK
CGDSRQGRDSRNRSLRRGIPQLKTRDSSKDLDLQEKLGGKHHTIPASQFSSAF
NT seq 702 nt   +upstreamnt  +downstreamnt
atggagccctcggccgactggctgtccgccgcggccgcccggggccgcgcggatgaggtg
cgggcgctgctcgaggagggggcgcctcccaatgcgcgcaacagtcacggtcggagcccg
attcaggtcatgatgatgggcagcgcccgcgtggccgagctgctgctgctccacggcgcg
gaccccaactgcgccgacccggccactctcacccgannnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnggagaggggccaccgcgaagtcgccgggtacctgcgcgcggcc
tcagggggcagggaaggaggtagccacgctggtacagacgcagcagaaggtcccacagtg
ggctgcgcagcagcgctctccctgccctcagcctggcgggcccggagtgcggaagcggtc
ggcgagcccagaacagctagcaggacagtggacgcgtgtgggattagcgaggctcggaag
tgcggagacagccggcagggtcgcgattccaggaacagatccctgcgccgagggataccc
caactgaagaccagagattcttcaaaggatcttgatcttcaggagaaattgggcggcaaa
catcacaccatccccgcctcccaattttcttctgctttttaa

DBGET integrated database retrieval system