Pteropus alecto (black flying fox): 102896443 Help Entry 102896443         CDS       T02993                                  Gene name BCL2 Definition (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism pale  Pteropus alecto (black flying fox) Pathway pale01521   EGFR tyrosine kinase inhibitor resistance pale01522   Endocrine resistance pale01524   Platinum drug resistance pale04064   NF-kappa B signaling pathway pale04066   HIF-1 signaling pathway pale04071   Sphingolipid signaling pathway pale04115   p53 signaling pathway pale04140   Autophagy - animal pale04141   Protein processing in endoplasmic reticulum pale04151   PI3K-Akt signaling pathway pale04210   Apoptosis pale04215   Apoptosis - multiple species pale04217   Necroptosis pale04261   Adrenergic signaling in cardiomyocytes pale04340   Hedgehog signaling pathway pale04510   Focal adhesion pale04621   NOD-like receptor signaling pathway pale04630   JAK-STAT signaling pathway pale04722   Neurotrophin signaling pathway pale04725   Cholinergic synapse pale04915   Estrogen signaling pathway pale04928   Parathyroid hormone synthesis, secretion and action pale04933   AGE-RAGE signaling pathway in diabetic complications pale05014   Amyotrophic lateral sclerosis pale05022   Pathways of neurodegeneration - multiple diseases pale05132   Salmonella infection pale05145   Toxoplasmosis pale05152   Tuberculosis pale05161   Hepatitis B pale05162   Measles pale05168   Herpes simplex virus 1 infection pale05169   Epstein-Barr virus infection pale05170   Human immunodeficiency virus 1 infection pale05200   Pathways in cancer pale05206   MicroRNAs in cancer pale05210   Colorectal cancer pale05215   Prostate cancer pale05222   Small cell lung cancer pale05226   Gastric cancer pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102896443 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     102896443 (BCL2)    04630 JAK-STAT signaling pathway     102896443 (BCL2)    04064 NF-kappa B signaling pathway     102896443 (BCL2)    04066 HIF-1 signaling pathway     102896443 (BCL2)    04071 Sphingolipid signaling pathway     102896443 (BCL2)    04151 PI3K-Akt signaling pathway     102896443 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102896443 (BCL2)   09143 Cell growth and death    04210 Apoptosis     102896443 (BCL2)    04215 Apoptosis - multiple species     102896443 (BCL2)    04217 Necroptosis     102896443 (BCL2)    04115 p53 signaling pathway     102896443 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102896443 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102896443 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     102896443 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     102896443 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102896443 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     102896443 (BCL2)    04722 Neurotrophin signaling pathway     102896443 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102896443 (BCL2)    05206 MicroRNAs in cancer     102896443 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     102896443 (BCL2)    05226 Gastric cancer     102896443 (BCL2)    05215 Prostate cancer     102896443 (BCL2)    05222 Small cell lung cancer     102896443 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102896443 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     102896443 (BCL2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102896443 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102896443 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     102896443 (BCL2)    05152 Tuberculosis     102896443 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102896443 (BCL2)    05161 Hepatitis B     102896443 (BCL2)    05162 Measles     102896443 (BCL2)    05168 Herpes simplex virus 1 infection     102896443 (BCL2)    05169 Epstein-Barr virus infection     102896443 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102896443 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102896443 (BCL2)    01524 Platinum drug resistance     102896443 (BCL2)    01522 Endocrine resistance     102896443 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pale01009]     102896443 (BCL2) Protein phosphatases and associated proteins [BR:pale01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102896443 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102896443 NCBI-ProteinID:  XP_006913779 LinkDB All DBs Position Unknown AA seq 225 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYRLSQRGYEWDAGDAGAAPPGATPAPGILSSQPXXXXXXX XXXXXAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV EELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWIQDNGG WDAFVELYGPNMRPLFDFSWLSLKALLSLALVGACISLGAYLGHK NT seq 678 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtatgataaccgagagatagtgatgaagtacatccac tataggctgtcgcagaggggctacgaatgggatgcgggagacgcgggcgccgcgcccccg ggggccacccccgcgccgggcattttgtcctcccagcccgnnnnnnnnnnnnnnnnnnnn nnnnnnnnnnnnnnngccgccgccgggcctgcgctcagccccgtgccacctgtggtccac ctgaccctgcgccaggctggtgatgacttctcccgtcgctaccgccgcgacttcgccgag atgtccagccagctgcacctgacgcccttcaccgcgaggggacgctttgccacggtggtg gaggagcttttcagggatggggtgaactgggggaggattgtggccttctttgagttcggt ggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtggacagcatcgcc ctgtggatgaccgagtacctgaatcggcacctgcacacctggatccaggataacggaggc tgggacgccttcgtggagctgtacgggcccaacatgcggcctctgttcgacttctcctgg ctgtctctgaaggcgctgctcagtctggccctggtgggagcttgcatcagcctgggggcc tacctgggccacaagtga

DBGET integrated database retrieval system