KEGG   Pteropus alecto (black flying fox): 102896443
Entry
102896443         CDS       T02993                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01521  EGFR tyrosine kinase inhibitor resistance
pale01522  Endocrine resistance
pale01524  Platinum drug resistance
pale04064  NF-kappa B signaling pathway
pale04066  HIF-1 signaling pathway
pale04071  Sphingolipid signaling pathway
pale04115  p53 signaling pathway
pale04140  Autophagy - animal
pale04141  Protein processing in endoplasmic reticulum
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale04217  Necroptosis
pale04261  Adrenergic signaling in cardiomyocytes
pale04340  Hedgehog signaling pathway
pale04510  Focal adhesion
pale04621  NOD-like receptor signaling pathway
pale04630  JAK-STAT signaling pathway
pale04722  Neurotrophin signaling pathway
pale04725  Cholinergic synapse
pale04915  Estrogen signaling pathway
pale04928  Parathyroid hormone synthesis, secretion and action
pale04933  AGE-RAGE signaling pathway in diabetic complications
pale05014  Amyotrophic lateral sclerosis
pale05022  Pathways of neurodegeneration - multiple diseases
pale05132  Salmonella infection
pale05145  Toxoplasmosis
pale05152  Tuberculosis
pale05161  Hepatitis B
pale05162  Measles
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05170  Human immunodeficiency virus 1 infection
pale05200  Pathways in cancer
pale05206  MicroRNAs in cancer
pale05210  Colorectal cancer
pale05215  Prostate cancer
pale05222  Small cell lung cancer
pale05226  Gastric cancer
pale05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102896443 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102896443 (BCL2)
   04630 JAK-STAT signaling pathway
    102896443 (BCL2)
   04064 NF-kappa B signaling pathway
    102896443 (BCL2)
   04066 HIF-1 signaling pathway
    102896443 (BCL2)
   04071 Sphingolipid signaling pathway
    102896443 (BCL2)
   04151 PI3K-Akt signaling pathway
    102896443 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102896443 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    102896443 (BCL2)
   04215 Apoptosis - multiple species
    102896443 (BCL2)
   04217 Necroptosis
    102896443 (BCL2)
   04115 p53 signaling pathway
    102896443 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102896443 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102896443 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102896443 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    102896443 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102896443 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    102896443 (BCL2)
   04722 Neurotrophin signaling pathway
    102896443 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102896443 (BCL2)
   05206 MicroRNAs in cancer
    102896443 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102896443 (BCL2)
   05226 Gastric cancer
    102896443 (BCL2)
   05215 Prostate cancer
    102896443 (BCL2)
   05222 Small cell lung cancer
    102896443 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102896443 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    102896443 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102896443 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102896443 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102896443 (BCL2)
   05152 Tuberculosis
    102896443 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102896443 (BCL2)
   05161 Hepatitis B
    102896443 (BCL2)
   05162 Measles
    102896443 (BCL2)
   05168 Herpes simplex virus 1 infection
    102896443 (BCL2)
   05169 Epstein-Barr virus infection
    102896443 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102896443 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102896443 (BCL2)
   01524 Platinum drug resistance
    102896443 (BCL2)
   01522 Endocrine resistance
    102896443 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pale01009]
    102896443 (BCL2)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102896443 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102896443
NCBI-ProteinID: XP_006913779
LinkDB
Position
Unknown
AA seq 225 aa
MAHAGRTGYDNREIVMKYIHYRLSQRGYEWDAGDAGAAPPGATPAPGILSSQPXXXXXXX
XXXXXAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
EELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWIQDNGG
WDAFVELYGPNMRPLFDFSWLSLKALLSLALVGACISLGAYLGHK
NT seq 678 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgagagatagtgatgaagtacatccac
tataggctgtcgcagaggggctacgaatgggatgcgggagacgcgggcgccgcgcccccg
ggggccacccccgcgccgggcattttgtcctcccagcccgnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnngccgccgccgggcctgcgctcagccccgtgccacctgtggtccac
ctgaccctgcgccaggctggtgatgacttctcccgtcgctaccgccgcgacttcgccgag
atgtccagccagctgcacctgacgcccttcaccgcgaggggacgctttgccacggtggtg
gaggagcttttcagggatggggtgaactgggggaggattgtggccttctttgagttcggt
ggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtggacagcatcgcc
ctgtggatgaccgagtacctgaatcggcacctgcacacctggatccaggataacggaggc
tgggacgccttcgtggagctgtacgggcccaacatgcggcctctgttcgacttctcctgg
ctgtctctgaaggcgctgctcagtctggccctggtgggagcttgcatcagcctgggggcc
tacctgggccacaagtga

DBGET integrated database retrieval system