KEGG   Pteropus alecto (black flying fox): 102896574
Entry
102896574         CDS       T02993                                 

Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04060  Cytokine-cytokine receptor interaction
pale04151  PI3K-Akt signaling pathway
pale04210  Apoptosis
pale04630  JAK-STAT signaling pathway
pale04640  Hematopoietic cell lineage
pale04664  Fc epsilon RI signaling pathway
pale05200  Pathways in cancer
pale05202  Transcriptional misregulation in cancer
pale05221  Acute myeloid leukemia
pale05310  Asthma
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102896574
   04151 PI3K-Akt signaling pathway
    102896574
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102896574
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102896574
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102896574
   04664 Fc epsilon RI signaling pathway
    102896574
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102896574
   05202 Transcriptional misregulation in cancer
    102896574
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102896574
  09163 Immune disease
   05310 Asthma
    102896574
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pale04052]
    102896574
   00536 Glycosaminoglycan binding proteins [BR:pale00536]
    102896574
Cytokines and growth factors [BR:pale04052]
 Cytokines
  Interleukins
   102896574
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate / Haparin
  Cytokines
   102896574
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 102896574
NCBI-ProteinID: XP_006923401
LinkDB
Position
Unknown
AA seq 149 aa
MHPTSPKMSSLPILHLLLLLLTAYASQAQGLPLPTSSTKEYVNMMMREIESILNKPPLPP
QEPLDVNEIYILNNEAFLMLNLDTFLEAAKNLQDKGMRIGKILEKLKETISSAPMTTEEP
IYIKKGNWDDFWRKMTKYLNFLQNYLKKS
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcatcctaccagcccaaagatgagcagcctccccatcctgcaccttctcctgctcctg
ctcacagcctatgcctctcaagcacaggggctgcccttgccgacgagctcgaccaaggaa
tacgtcaacatgatgatgagggaaattgagagcatcctgaacaaaccgcctttgcctcca
caagaaccgttggacgtaaatgagatatacatcctgaacaatgaggcctttctgatgcta
aacctggataccttcctggaagctgccaagaatttgcaggataaaggaatgagaattggg
aaaattcttgagaaactcaaagagacaatctcgtccgcccccatgaccacggaagagcca
atctatatcaagaaaggtaactgggacgatttctggaggaaaatgactaaatatctgaac
ttccttcagaactacctcaagaagtcctag

DBGET integrated database retrieval system