KEGG   Pteropus alecto (black flying fox): 102896950
Entry
102896950         CDS       T02993                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale03320  PPAR signaling pathway
pale04068  FoxO signaling pathway
pale04071  Sphingolipid signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04210  Apoptosis
pale04510  Focal adhesion
pale04660  T cell receptor signaling pathway
pale04664  Fc epsilon RI signaling pathway
pale04722  Neurotrophin signaling pathway
pale04910  Insulin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale04931  Insulin resistance
pale04960  Aldosterone-regulated sodium reabsorption
pale05145  Toxoplasmosis
pale05205  Proteoglycans in cancer
pale05213  Endometrial cancer
pale05215  Prostate cancer
pale05223  Non-small cell lung cancer
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102896950 (PDPK1)
   04071 Sphingolipid signaling pathway
    102896950 (PDPK1)
   04151 PI3K-Akt signaling pathway
    102896950 (PDPK1)
   04152 AMPK signaling pathway
    102896950 (PDPK1)
   04150 mTOR signaling pathway
    102896950 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102896950 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    102896950 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102896950 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102896950 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    102896950 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102896950 (PDPK1)
   03320 PPAR signaling pathway
    102896950 (PDPK1)
   04919 Thyroid hormone signaling pathway
    102896950 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102896950 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102896950 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102896950 (PDPK1)
   05231 Choline metabolism in cancer
    102896950 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    102896950 (PDPK1)
   05213 Endometrial cancer
    102896950 (PDPK1)
   05223 Non-small cell lung cancer
    102896950 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102896950 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102896950 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102896950 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102896950 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102896950 (PDPK1)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102896950 (PDPK1)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   102896950 (PDPK1)
Membrane trafficking [BR:pale04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    102896950 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 102896950
NCBI-ProteinID: XP_006913986
LinkDB
Position
Unknown
AA seq 557 aa
MARTTSQLYDTVPIQSSVVLCSCPSPSMVRTQTESGTAPGVPSGGSRQGPTMDSTAAQSR
PSANSLQHTTQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI
IKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFD
ETCTRFYTAEMVSALEYLHGRGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQAR
ANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESITWENLHHQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSHSLSALDTGLPQRAGSNIEQYIHGL
DTNSFELDLLFSEDEKKLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLT
EGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKI
QEVWRHRYQSHPDAAVQ
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggccagaaccaccagccagctgtatgacaccgttcctattcagtccagtgtggtgtta
tgttcctgcccatccccatcaatggtgaggacccagactgagtccggcacggcccctggc
gttcccagcggtggcagcaggcagggtcccaccatggacagcaccgcagctcagtcccgc
ccaagtgccaactcgctgcaacacaccacacagccaccaccgcagcctcggaagaaacgg
cctgaagacttcaaattcgggaaaattcttggcgaaggctctttttcaacggttgtcctg
gcccgagaactggcaacctcaagggaatatgctattaaaattctagagaaacgtcacatt
atcaaagagaacaaggtcccgtatgtaaccagagagagagatgtgatgtcacgcctggat
caccctttctttgttaaactttacttcacgtttcaggatgatgaaaagctgtattttggc
cttagttatgccaaaaatggagaactacttaaatacattcgcaaaattggttcattcgat
gagacgtgcacccgattttacacagccgagatggtgtctgctctagagtatttgcacggc
aggggcatcatccacagggacttgaaaccagaaaacattttgttaaatgaagatatgcac
atccagatcacagattttggaacagcaaaagtattatccccagagagtaaacaagccagg
gccaactcatttgtaggaacagcccagtatgtatctccagagctgctcacagagaaatcc
gcctgtaaaagttcagacctttgggctcttggatgtataatataccagcttgtggcagga
ctgcctccgtttcgagcaggaaacgaataccttatatttcagaagatcattaagttggag
tatgactttcctgaaaaattcttccctaaggcacgagacctggtggaaaaacttttggtt
ttagatgccacaaagcggttaggctgtgaagaaatggaagggtatggccctctgaaagct
catccattcttcgagtccatcacgtgggagaatctgcatcatcagacgcctccgaagctc
acagcctatttaccggccatgtcggaagatgatgaagactgctatggaaactacgacaat
ctcctgagccagtttggctgcatgcaggtgtcatcgtcatcctcccactccctgtctgcc
ttggacacgggtctgccacagagagcgggcagcaacatcgagcagtatatccatggcctg
gacactaattcttttgaactggacttactgttctctgaagatgagaagaagttattattg
gagaagcaggccagtggaaacccttggcaccagtttgtagaaaataacttaatactaaaa
atgggtcctgtagataagcgaaagggtttatttgcacgacgacgacagttactgctcaca
gaagggccacacttatattatgtggatcctgtcaacaaagtcctgaaaggtgaaattcca
tggtcgcaagaactccgaccagaggccaagaattttaaaaccttctttgtccacacgcca
aacaggacatattacctgatggacccgagtgggaatgctcacaaatggtgcaaaaagatc
caggaggtgtggaggcacagataccagagccacccagacgccgctgtgcagtga

DBGET integrated database retrieval system