KEGG   Pteropus alecto (black flying fox): 102896980
Entry
102896980         CDS       T02993                                 

Gene name
BUB1B
Definition
(RefSeq) mitotic checkpoint serine/threonine-protein kinase BUB1 beta
  KO
K06637  mitotic checkpoint serine/threonine-protein kinase BUB1 beta [EC:2.7.11.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04110  Cell cycle
pale05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102896980 (BUB1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102896980 (BUB1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102896980 (BUB1B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pale03036]
    102896980 (BUB1B)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102896980 (BUB1B)
Protein kinases [BR:pale01001]
 Serine/threonine kinases: Other
  BUB family
   102896980 (BUB1B)
Chromosome and associated proteins [BR:pale03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     102896980 (BUB1B)
SSDB
Motif
Pfam: Mad3_BUB1_I Pkinase Mad3_BUB1_II Mad3_BUB1_I_2
Other DBs
NCBI-GeneID: 102896980
NCBI-ProteinID: XP_006920560
LinkDB
Position
Unknown
AA seq 1061 aa
MAAMKKEEGGPSEAMSLEGDEWELSKENVQPLRQGRSMSTLQGILAQQESARNTTLQQQK
RAFESEIRFYTGNDPLDVWDRYINWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYNDP
RFLSLWLKLGHLCNEPLDMYSYLHNQGIGISLAQFYISWAEEYEARENFKKADMIFQDGI
QQKAEPLERLQSQHRQFQARVTRQTLMALEKEEEEVFGASVPQRSTLAELKSKGKKTARA
PISRIGGALKAPNQNRGLQNPFPQPMQSNSRITVFDENADEASIAELSTPTVQPWIAPPV
SRAKENELQAGPWNTGRPLEHRPRGNTASVTAVPSMLPSFTPYVEETAQQPVMTPCKIEP
SINHVLSTRKPGKEEGDLLQRVQSHQQDSEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVF
RKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQHERTGDQQEEMSTKETVELQ
IASVSQEIPGMTLSNSVCPINSCARETSLAENIWQEQPHSKDPSIPFSIFDEFLLSEKRN
ISPSADPPRVLVQRRPLAVLKTSENITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNITI
CPNPEDTCDFASAARFVSTPFHEIISLKDLPSDSERLLQEEDLDVKTSEDQQTTCGTIYN
PTLSIKKLSPIIEDSREATHSSGFSGSSASVISTCSLKCLQIPEKLELTNETAENPVQSP
WCSQYRRQLLKSLPELSASVEIFVEDRPMPKLETEKEIELGNEDYCIKQEYLVCEDYKLF
WVTPRNSTELTIIKVSSQTVPWDFYINLKLKERLNEECDHLCSYYQYQDGCIVWHQYINC
FTLQDLFQHSEFITHEITVLIVYNLLTIVEKLHKAEIVHGDLSPRSLILRNRIHDPYDCN
KNNQALNIVDFSYSVDLRAQLDIFALSGFRTVQILEGQKILANCSSPYQVDLFGIADLAH
LLLFKEHLQVFWDGSLWKLSQNISELKDGELWNKFFVRILNASDESTVSVLRELAAEINW
VFDTTFQSHLNKALWKVGKLIGPGALLFQQDRQSSLSQNPA
NT seq 3186 nt   +upstreamnt  +downstreamnt
atggcagcaatgaagaaggaagagggtggaccgagtgaagccatgtctctggagggagat
gaatgggagctgagtaaagaaaatgtacaacctttaaggcaggggcggagcatgtccaca
cttcagggaatattggcacagcaagaatctgcccgtaacactactctacagcagcagaaa
cgggcatttgaatctgaaattcgattttacactggaaatgaccctctggatgtttgggat
aggtatattaactggacagagcagaactatcctcaggggggcaaggagagtaatatgtca
acattattagaaagagctgtagaagcactacaaggagaaaaaagatattataatgatcct
cgatttctcagtctctggcttaaattgggacatttatgcaatgagcctttggatatgtac
agttatttacacaaccaagggattggcatttcacttgctcagttctatatttcatgggct
gaagaatatgaagctagagaaaactttaagaaagcagacatgatatttcaggatggaatt
caacagaaggctgaaccactggaaagactgcaatcccagcaccgacaattccaagctcga
gtgactcggcaaactctgatggcacttgagaaagaagaagaggaagtttttggagcctct
gtaccacagcgaagcacactggctgaactaaaaagcaaagggaaaaagacagcaagagct
ccaatcagccgtataggaggtgctctcaaggctccaaaccagaaccgaggactccaaaat
ccatttcctcaaccgatgcaaagtaattctagaattactgtttttgatgaaaatgctgat
gaggcttctatagcagagctgtctacgcctacagtccagccatggattgcaccccctgtg
tccagggccaaagaaaatgagctgcaagcaggcccttggaacacaggcaggcctttggaa
cacagacctcgtggcaatacagcttctgtgacagctgtaccctctatgcttcccagtttt
actccgtatgtggaagagactgcacaacagccagttatgacaccatgtaaaattgaaccc
agtataaaccacgttctaagcacaagaaagcctggaaaggaagaaggggatctcctgcaa
agggttcaaagccatcagcaagattctgaggagaagaaagagaagatgatgtattgtaag
gagaaaatttatgcaggagttggggagttctcctttgaagagatccgggctgaagttttc
cgaaagaaattaaaagagcaaagggaagctgagctactgaccagtgcagagaagagagca
gaaatgcagaaacaaattgaagagatggagaagaagctgaaagaaattcaaaccactcag
catgaaagaacgggtgatcagcaagaagagatgtctacaaaggagacagttgaactgcaa
attgcttcagtgtctcaggaaatcccaggaatgactctatccaattctgtttgtccaata
aactcttgtgccagggaaacttcacttgcagaaaacatttggcaagaacaacctcattct
aaagatcccagtatacctttctccatttttgatgagtttcttctttcagaaaaaaggaat
atcagtccctctgcagatcccccacgggttttagtccaacgaagaccccttgcagttctc
aaaacttcagaaaacatcacctcaaatgaggatgtgtctccagatgtttgtgatgaattc
acaggaattgagcccttgagtgaagatgctattatcacaggtttcaggaatataactatt
tgtcctaacccagaagacacttgtgactttgctagcgcagctcgttttgtatccactcct
tttcatgagataatatccttgaaggatctcccttctgactctgagagacttttgcaggaa
gaggatctagatgtgaagacctctgaggaccaacagactacttgtggcactatctacaat
ccaactctcagcatcaagaagctgagcccaattattgaagatagccgcgaggccacacac
tcctctgggttctctggatcttctgcctcagttataagcacctgctccctcaaatgcctt
caaattcctgagaaactggagcttactaatgaaactgcagaaaatcctgttcagtcaccc
tggtgttcacagtatcgtagacaactactaaaatccctaccagagctgagtgcctctgta
gagatttttgtagaagatagaccaatgcctaagttggaaacagagaaggaaattgaatta
ggtaatgaggattattgcattaaacaagaatacctagtatgtgaagattacaaattattc
tgggtgacaccaagaaactctacagaattaaccataataaaggtatcttctcaaactgtc
ccatgggacttttatatcaacctcaagttaaaggaacgtttaaatgaggagtgtgatcat
ttgtgcagctattatcaataccaagatggttgtattgtttggcaccagtatataaactgc
ttcacccttcaggatctttttcagcacagtgaatttattacccatgaaataacagtgttg
atagtttataaccttttgacaatagtggagaaactacacaaagcggaaatagtccatggt
gacttgagtccaaggagtctgattcttagaaacagaatccacgatccctatgattgtaat
aagaacaatcaagctttgaacatagtggacttttcctacagtgtcgacctcagggctcag
ctagacatttttgccctcagtggctttcggactgtacagatcctggaaggacaaaagatc
ctggctaactgttcttctccctaccaggtagatctgtttggtatagcagatttagcacat
ttactattgttcaaggaacatctacaggtcttctgggatgggtccctctggaaacttagc
caaaatatttctgagctaaaagatggtgaattgtggaataaattctttgtgcggattctg
aatgccagtgatgagtccacagtgtctgttctgagggaacttgcagcagaaatcaattgg
gtgtttgataccacatttcaaagtcacctgaacaaagctttatggaaggtagggaagtta
atcggtcctggggctttgctcttccagcaagataggcagtcaagtctctcacagaatcct
gcctaa

DBGET integrated database retrieval system