KEGG   Pteropus alecto (black flying fox): 102897268Help
Entry
102897268         CDS       T02993                                 

Definition
(RefSeq) anionic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04080  Neuroactive ligand-receptor interaction
pale04972  Pancreatic secretion
pale04974  Protein digestion and absorption
pale05164  Influenza A
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102897268
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102897268
   04974 Protein digestion and absorption
    102897268
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    102897268
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pale01002]
    102897268
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pale04147]
    102897268
Enzymes [BR:pale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102897268
Peptidases [BR:pale01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102897268
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102897268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 102897268
NCBI-ProteinID: XP_006910523
UniProt: L5KQU0
LinkDB All DBs
Position
Unknown
AA seq 247 aa AA seqDB search
MNPLLILAVVGAAVAFSTDDDDDKIVGGYTCKEGSVPYQVSLNSGYHFCGGSLISNQWVV
SAAHCYKSRIQVRLGEYNIEEVEGNEQFINSAKVIRHPSYSSQTLDNDIMLIKLSSTATL
NSRVSTISLPSSCASTGTQCLVSGWGNTLSSGSNYPELLQCLNVPVLSQAKCEAAYPGQI
TSNMFCAGYLEGGKDSCQGDSGGPVVCSNKLQGIVSWGYGCAQKNKPGVYTKVCKFVDWI
KKTVASN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctctcctgatcctggccgttgtgggagctgctgttgctttctccactgatgac
gacgacgacaagatcgtggggggctacacctgcaaggagggctccgtcccctatcaggtg
tccctgaactctggctaccacttctgcggaggctccctcatcagtaaccagtgggtggtg
tccgccgctcactgctacaagtcccgcatccaggtgaggctgggagagtacaacatcgaa
gaggtggaggggaacgagcagttcatcaactccgccaaggtcatccgccaccccagctac
agcagccagaccctggacaatgatatcatgctgatcaagctgtcctcgacggcgaccctc
aacagccgggtgtccaccatctccctgcccagctcctgcgcgtccaccggcacccagtgc
ctcgtctccggctggggcaacaccctgagctctggaagcaactaccccgagctgctgcag
tgcctgaacgtgcccgtgctgagccaggccaagtgcgaagccgcgtaccctgggcagatc
accagcaacatgttctgcgctggctacctggaggggggcaaggactcctgccagggcgac
tctggtggccccgtggtctgcagcaataagctccaaggaatcgtctcctggggctatggc
tgcgcccagaagaacaagcctggcgtctacaccaaagtctgcaaattcgtggactggatt
aagaagaccgtggccagcaactaa

DBGET integrated database retrieval system