KEGG   Pteropus alecto (black flying fox): 102897292Help
Entry
102897292         CDS       T02993                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00020  Citrate cycle (TCA cycle)
pale00190  Oxidative phosphorylation
pale01100  Metabolic pathways
pale01200  Carbon metabolism
pale04714  Thermogenesis
pale04932  Non-alcoholic fatty liver disease (NAFLD)
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05016  Huntington disease
Module
pale_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pale_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pale_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102897292 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102897292 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102897292 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102897292 (SDHA)
   05012 Parkinson disease
    102897292 (SDHA)
   05016 Huntington disease
    102897292 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102897292 (SDHA)
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102897292 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 102897292
NCBI-ProteinID: XP_024906279
LinkDB All DBs
Position
Unknown
AA seq 680 aa AA seqDB search
MVAAPLQLAQCECTLHRRRIFGYKFPVPSRHFSLSQQRPAALQTGSRDFHFTVDGNKRSS
AKVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQ
GGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTE
DGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDL
LMENGECRGVIALCIEDGSIHRLRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAG
LPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVS
RSMTLEIREGRGCGPEKDHVYLQLHHLPPEQLAIRLPGISETAMIFAGVDVTKEPIPVLP
TVHYNMGGIPTNYKGQVLRHVHGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFG
RACALSIAESCRPGDKVPSIKANAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQAHAA
VFRVGSVLQEGCGKLSQLYGDLRHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEA
RKESRGAHAREDYKERIDEYDYSKPIQGQQQKPFEQHWRKHTLSYVDSRTGKVSLEYRPV
IDKTLNEADCATVPPAIRSY
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggtagctgcccccttgcagctagcccagtgcgagtgtacgctccacagaaggagaatt
tttggttacaagttccctgtcccttcaagacacttttctctgtctcagcagcgtccagca
gccctgcagacaggaagtcgtgactttcacttcactgttgacgggaataagaggtcgtct
gctaaagtttcagattcgatttccacacagtacccagtagtggatcatgaatttgatgcc
gtggtggtgggcgccggaggtgcaggcttgcgagctgcatttggcctttcggaggcaggg
ttcaacacggcctgtgtcacgaagctcttccccaccaggtcccacaccgtggcagcccag
ggaggaatcaatgctgctctggggaacatggaggaggacaactggaggtggcacttctat
gacaccgtgaagggctctgactggctgggggaccaggatgccatccactacatgacagag
caggcccctgcctctgtggtcgagctggagaactacggcatgccgttcagcagaactgag
gacggcaagatctaccagcgcgctttcggcggacagagcctcaagtttgggaaaggcggg
caggcccaccggtgctgctgcgtggctgaccgcaccggccactcactgctgcacacgttg
tatggaaggtccttgcggtacgacaccagctatttcgtggagtacttcgccttggacctc
ttgatggagaacggggagtgtcgtggcgtcatcgcactttgcatagaagacgggtccatc
catcgcctaagagcaaagaacacggttgtagccactggaggctacgggcgcacctacttc
agctgcacgtcggcccacaccagcaccggcgacggcaccgccatgatcaccagggcaggg
cttccctgccaggacttggaatttgttcagttccaccccacagggatatacggggctggc
tgtctcatcacggaggggtgccgtggagagggcggcattctcattaacagtcaaggcgag
aggttcatggagcggtacgcccccgtcgccaaggacctggcctccagagacgtcgtgtct
cggtccatgaccctggagatccgtgagggcagaggctgtgggcctgagaaagatcatgtc
tacctgcagttgcaccacctgcccccggagcagctggccatccgcctgcctggcatttca
gagacagccatgatctttgcgggtgtggatgtcaccaaagagccgatccctgtccttccc
accgtgcattacaacatgggtggcattcccaccaactacaaggggcaggttttgaggcac
gtgcacggccaggaccaggtcgtgcccggcctgtacgcctgtggggaggccgcctgcgcc
tcggtgcacggcgccaaccgccttggggctaactcactgctggacctggtcgtctttggc
cgggcatgcgccctgagcatcgcggagtcctgcagacccggagataaagttccctcgatt
aaagcaaatgctggggaagaatctgtcatgaatcttgacaaattgagatttgccgacggg
agcataagaacatcggaactgcgactcagcatgcagaagtccatgcaggcgcacgcggcg
gtgttccgggtgggcagcgtgctgcaggagggctgcgggaaactcagccagctctacggg
gacctgaggcacctgaagacctttgaccgaggaatggtctggaacacggacctggtggag
acgctggagctgcagaacctgatgctgtgcgcgctgcagaccatttacggggcggaggcc
cggaaggagtcgcgcggcgcccacgccagggaggactacaaggagcggatcgatgagtac
gattattccaagcccatccagggtcagcagcagaagccgtttgagcagcactggaggaag
cacacgctttcctacgtcgatagcaggactgggaaggtctccctggaatacaggcctgta
atcgacaaaactttaaacgaggctgactgtgccacggtccccccagccattcgctcctac
tga

DBGET integrated database retrieval system