KEGG   Pteropus alecto (black flying fox): 102897687
Entry
102897687         CDS       T02993                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale04115  p53 signaling pathway
pale04210  Apoptosis
pale04215  Apoptosis - multiple species
pale05010  Alzheimer disease
pale05012  Parkinson disease
pale05014  Amyotrophic lateral sclerosis
pale05016  Huntington disease
pale05020  Prion disease
pale05022  Pathways of neurodegeneration - multiple diseases
pale05134  Legionellosis
pale05152  Tuberculosis
pale05160  Hepatitis C
pale05161  Hepatitis B
pale05162  Measles
pale05164  Influenza A
pale05168  Herpes simplex virus 1 infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102897687 (APAF1)
   04215 Apoptosis - multiple species
    102897687 (APAF1)
   04115 p53 signaling pathway
    102897687 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102897687 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102897687 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102897687 (APAF1)
   05012 Parkinson disease
    102897687 (APAF1)
   05014 Amyotrophic lateral sclerosis
    102897687 (APAF1)
   05016 Huntington disease
    102897687 (APAF1)
   05020 Prion disease
    102897687 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    102897687 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102897687 (APAF1)
   05152 Tuberculosis
    102897687 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102897687 (APAF1)
   05160 Hepatitis C
    102897687 (APAF1)
   05164 Influenza A
    102897687 (APAF1)
   05162 Measles
    102897687 (APAF1)
   05168 Herpes simplex virus 1 infection
    102897687 (APAF1)
   05169 Epstein-Barr virus infection
    102897687 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102897687 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 WD40_like eIF2A Ge1_WD40 Utp8 AAA_16 Hira AAA_22 CARD NACHT
Other DBs
NCBI-GeneID: 102897687
NCBI-ProteinID: XP_006914631
LinkDB
Position
Unknown
AA seq 1195 aa
MLIKMILKKDNYTYISFYNALLHEGYKDLAAFLHAGLPVVPSSNGKDSCGGITSYVRTVL
CEGGVPQRPVVFVTRKKLVSAIQQKLFKLNSEPGWVTVYGMAGCGKSVLAAEAVRDHDLL
EGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRK
HPRSLLILDDIWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESDLGKEKGLEI
LSLFVNMKKADLPEQAHNIIKQCQGSPLVVSLIGALLRDFPSRWEYYLRQLQNKQFKRIR
KSSSYAYEALDEAMSISVEMLREDIKDYYTDLSIFQKDVKVPTKVLCVLWDMETEEVEDI
LQEFVNKSLLFCDRNGNSFRYYLHDLQVDFLTEKNRDQLQDLHKKVITQFQRYYQPHTLS
LDQEDCMYWYSFLTYHMASANMHKELCALMFALDWIKAKTEFAGPAHLIHEFVEYRHILD
EKDCAVCENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLKAKQEVDNGMLY
LEWINKKNIKNLSRLVVRPHTDAVYHACFSENGQRIASCGADKTLQVFKAETGEKLLEIR
AHEDEVLCCAFSTDDRFIATCSVDKKVKIWDSMTGKLVHTYDEHSEQVNCCQFTNNSHHL
LLATGSSDCFLKLWDLNQTECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKFWDVKS
ANERKSINVKQFFLSSEEPQEEMEVMVKCCSWSSDGSRIMVAAKNKIFLFDIHTSGLLAE
IHTGHHSTIQYCDFSPQNHLAVVALSQYCVELWNMDSCLKVADCRGHLSWVHCAMFSPDG
TSFLTSSDDQTIRLWETKKVCENSAIVLKQEIDVAFQENEVMVLAVDNIRRLQLINGKTS
QIDYLAEAQVSCCCLSPHLQYIAFGGNDGALEILELLNNRIFQSRDGHKNTVRHIQFTAD
GKTLISSADDSAIQVWNWQSEEYVSLQAHQETVKDFRLLPNSRLLSWSFDGTVKIWNITT
GRMEKDFVCHQDTVLSCDVSPDATKFSSTSADKTAKIWSFELLSPLHELKGHKGCVRCSV
FSVDSTLLATGDDNGEIRIWNASNGELLHLCDPISVEEGAATHGGWVTDLCFSPDSKMLV
SAGGYLKWWNVVTGECSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILRILE
NT seq 3588 nt   +upstreamnt  +downstreamnt
atgctgattaaaatgatacttaaaaaagataattatacctacatatcattctacaatgct
ctattacatgaagggtataaagatcttgctgcctttctccatgctggccttcccgttgtc
ccttcttccaatggcaaggattcatgtggtggaataacttcctatgtaaggacagtcttg
tgtgaaggaggagtaccacagaggccagtcgttttcgttacgaggaagaagctggtgagc
gcaattcagcagaagctcttcaaactgaatagtgaaccaggatgggtcactgtgtatgga
atggcaggttgtgggaagtctgtattagctgcagaagctgtacgagatcatgacctctta
gaaggttgtttcccagggggtgtgcattgggtttcagttgggaaacaagacaaatctggg
cttctgatgaaactgcagaatctttgtacacgattggatcaggatgagagcttctcccag
aggcttccacttaatatcgaagaggctaaagaccgtcttcgcatcctgatgctccgcaaa
cacccaaggtctctgttgatcttggatgatatttgggatccttgggtgttaaaagctttt
gacaatcaatgtcagattcttcttacaaccagagacaagagtgtcacagattcggtaatg
ggtcctaagtatgtagtccccgtggagagtgacttaggaaaagaaaaaggacttgaaatt
ttatccctttttgttaatatgaagaaagcagatttgccggaacaagctcataatattata
aaacaatgtcaaggttctcctcttgtagtgtctttaattggtgcacttttacgtgatttt
cccagccgctgggagtactacctcaggcaacttcagaataagcaatttaagaggataagg
aaatcttcatcttatgcttatgaggctctggatgaagccatgtctataagtgttgaaatg
ctcagagaagacatcaaagattattacacagatctttctatttttcagaaggatgtcaag
gtaccaacaaaggtgctatgtgttctctgggacatggaaactgaagaagttgaagacata
ctgcaggagtttgttaataaatctctattattctgtgatcggaatggaaactcatttcgt
tattatttacatgatcttcaagtagatttccttacagagaagaatcgtgaccagcttcag
gatctacataagaaagtaatcactcaattccagcgatattaccagccacatactctttca
ctagaccaggaagactgcatgtactggtatagttttctgacctatcacatggccagtgcc
aatatgcacaaagaactttgtgctttaatgtttgccctggattggattaaagcaaaaacg
gaatttgcaggccctgctcatctgattcatgaatttgtggaatacaggcatatactggat
gaaaaggattgtgcagtctgtgagaatttccaggagtttttatctttaaatggacatctt
cttggacgacagccatttcctaatattgtacaactgggtctctgtgaacctgaaacttca
gaagtttatcagcaagctaagctgaaggccaagcaggaggtcgataacggaatgctttac
ctggagtggataaacaaaaaaaacatcaagaatctctcccgcttagttgtccgcccccat
acagatgctgtttaccatgcttgcttttctgagaatggtcaaagaatagcttcttgtgga
gctgataaaactttacaggtgttcaaagctgaaacaggagagaaacttctagaaatcagg
gcccatgaagatgaagtgctttgctgtgcattctctacggatgacagatttatagcaacc
tgctcagtcgataaaaaagtgaagatttgggattctatgactgggaaactagtacatacc
tatgatgagcactcagagcaagtcaattgctgccaattcaccaacaacagtcatcacctt
ctcttagccactgggtcaagtgactgcttcctcaaactctgggatttgaatcaaacagaa
tgtcgaaataccatgtttggccacaccaattcagtcaatcactgcagattttcaccggat
gataagcttttggctagttgttcagctgatggaacattaaagttctgggatgtgaaatca
gcaaatgagaggaaaagcattaatgtgaagcagttcttcctaagttcagaggagcctcaa
gaggaaatggaagtgatggtgaaatgttgttcatggtcttctgatggttctaggataatg
gtggcagcaaaaaataaaatctttctttttgacattcataccagtggtctcttggcagaa
atccatacaggccatcacagcaccatccagtactgtgacttctccccccaaaatcatttg
gcagtggtggctttgtcccagtattgtgtggagttgtggaacatggactcatgtttaaaa
gttgctgattgccgaggacatttaagttgggttcattgtgcgatgttttctcctgatgga
acatcatttttgacatcttctgatgaccagacaatcaggctctgggagacaaagaaagta
tgtgagaactctgctatagtattaaagcaagaaatagatgttgcgtttcaagaaaatgaa
gtgatggttcttgcagttgacaatataagacgtcttcaactcattaacggaaaaacaagt
cagattgattatctggctgaagctcaagttagttgctgctgcttaagtccacatctgcag
tacattgcgtttggaggcaacgatggagcccttgagattttagaactcctaaacaacaga
atattccaatccagggatgggcacaagaacactgtccggcacatccaattcacagctgat
ggaaagactcttatttcaagtgctgatgattctgcaatacaggtatggaattggcaatca
gaggaatatgtctctctgcaagcccatcaggaaacagtgaaagactttaggctcttgcca
aattcaagactgctttcttggtcatttgatggaacggtgaagatatggaatattactact
ggaagaatggaaaaagactttgtctgtcaccaggatacagtactttcttgtgatgtttct
cctgatgctaccaagttttcatctacctctgctgacaagactgcaaagatttggagcttt
gaactcctttcccctcttcatgaattgaagggccacaaaggctgtgtgcgctgctctgtc
ttctctgtggacagtaccctgctggcgactggagatgacaatggagaaatcaggatatgg
aatgcctcgaacggtgagcttcttcatttgtgtgatccgatttcggtagaagaaggagct
gctacccatggaggctgggtgactgacctttgcttttctccggatagcaaaatgcttgtc
tctgctggaggctatcttaagtggtggaatgttgtcactggggaatgctcacagaccttc
tacacaaatggaaccaaccttaagaaaatacatgtgtcccctgacttcaaaacatatgtg
actgttgataatcttggtattttatatattttacggattttagagtaa

DBGET integrated database retrieval system