KEGG   Pteropus alecto (black flying fox): 102897997Help
Entry
102897997         CDS       T02993                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00052  Galactose metabolism
pale00500  Starch and sucrose metabolism
pale01100  Metabolic pathways
pale04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102897997
   00500 Starch and sucrose metabolism
    102897997
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102897997
Enzymes [BR:pale01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102897997
    3.2.1.20  alpha-glucosidase
     102897997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102897997
NCBI-ProteinID: XP_006910526
LinkDB All DBs
Position
Unknown
AA seq 1827 aa AA seqDB search
MARKKLKDFTSLELMLSVLLLLVFLITIPLLVLSARDSSESQGPGTTTATPSTTPDSATC
PVVNELERINCIPDQSPTKATCDQRGCCWRPQGTMRVPWCYYSKSHGYQVEGDLASTGTG
FTARLKRSPSPSLFGNDIDNVLLTAEYQTANRFHFKLTDQNKDRYEVPHEHVQPFRGNAA
SPLTYEAEVSKQPFSIKVTRKSNNHVLFDSSIGPLLFADQFLQLSIRLPSANVYGLGEHV
HQQYLHDMNWKTWSIFARDTTPNGDGTNLYGTQTFFLCLEDASGLSFGVFLMNSNAMEIV
LQPTPAVTYRAIGGILDFYVFLGNTPEQVVQEYLELIGRPALPAYWTLGFHLSRYDYGSL
DNLKEVVDRNWAAQLPYDVQHADIDYMDERKDFTYNPVDFKGFPEFAKELHNNGQKLVII
VDPAISNGSSPSNPYGPYDRGSDMKIWVNASDGVTPLIGEVWPGKTVFPDYTNPKCAVWW
ANEFELFHNQVEFDGIWIDMNEVSNFVDGSLSGCSTSNLNYPPFTPRVLDGYLFCKTLCM
DAVQHWGKQYDVHNLYGYSMAIATAEAVKTVFPNKRSFIITRSTFAGSGKFAAHWLGDNA
ATWNDLRWSIPGVLEFNLFGIPMVGPDICGYALDAPEELCRRWMQLGAFYPFSRNHNGQG
YKAQDPASFGADSLLLNSSRHYLSIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYRDSS
TWDVHQQFLWGPGLLITPVLHEGAEKVMAYVPDAVWYDYETGGQVRWRKQKVEMELPGDK
IGLHLRGGYIFPTQQPAITTAASRRNPLGLIIALDDNKEAKGELFWDDGETKDTVANKVY
LFCEFSVTQNRLDVKILQSTYKDPNNLVFKEIKILGTQEPNNITVKHNGVSSQVSPNVTY
DSNLQVALITGLDLVLGEVYTVEWDLKIQDAEKIDCYPDENGASAENCVARGCAWEAPGS
PGVPFCYFVEDLYSVSDVQYDSHRATAVISLKSALYANAFPSTPVSPLRLSVTYHKNDML
QFKIYDPSNNRYEVPVPLNVPRVPSSTSEGQLYDVLIKKNPFGIEIRRKSTGTAIWDSQL
LGFTFNDMFIRISTRLPSRHIYGFGETEHTAYRRDLNWHTWGMFSRDQPPGYKKNSYGVH
PYYLALEEDGSAHGVLLLNSNAMDVTFQPTPALTYCTTGGVLDFYVFLGPTPELVTQQYT
ELIGRPVMVPYWALGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFT
LSPKFAGFPALIARMKADGMRVILILDPAISGNETQPYLAFTRGVEGDVFIKAPAGGGIV
WGKVWPDFPDVVINGSLDWESQVERYRAYVAFPDFFRNSTATWWKRELRELYTNPWEPEK
SLKFDGIWIDMNEPASFVNGAVPPGCKDATLNRPAYMPHLESRDKGLSSKTLCMESEQIL
ADGSRVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTAA
WDQLRKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFARNHNTIGTR
RQDPVSWDDTFMNISRSVLQTRYTLLPYLYTLMHMAHTEGSTVVRPLLHEFVSDHVTWDV
DSQFLLGPAFLVSPVLEPNARNVTAYFPRARWYDFYTGVDIQARGEWKSLPAPLDHINLH
VRGGYILPWQEPAQNTHFSRQKFLGFKVALDDEGTATGRLFWDDGQSIDTYENGLYYLAH
FSASQNTMESHVIFNKYINDTNPLKVGYIEIWGVDSVPISSVSVSVSSMVITPNFTHNPT
TQVLSIDVTNRNISLHNFISLTWRSTL
NT seq 5484 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaagattttacttctttggagctcatgctcagtgttcttctg
cttctcgtgtttctcatcactattccgctccttgtgctttcagctagagattcttcggag
tcacaaggtcctgggacaacaacagctacgccaagtaccactcccgattctgccacatgc
cctgtggtaaatgaattggagaggataaactgcatccctgaccagtcacccacaaaggcc
acgtgtgaccagcgaggctgctgctggagaccccagggaaccatgcgtgtgccctggtgc
tactattctaagagtcatggctatcaagtggagggcgaccttgcgagcacaggcacaggg
ttcacagcccggctgaaaaggtcgccttctccgtccctgtttgggaatgacattgacaac
gtccttctcacagcggaataccagacagctaatcgcttccacttcaagttaactgaccag
aacaaggacaggtatgaagtgccccacgaacatgtccaacccttcagaggaaatgctgct
tctcctttgacctatgaagcggaggtctccaagcagccgttcagcatcaaagtgaccaga
aaaagcaacaatcacgttctgtttgactcaagcattggccccctcctgttcgctgaccag
ttcctgcagctctctattcgactgccgagtgccaacgtgtacggtctgggggaacacgtg
caccagcagtacctccatgatatgaattggaagacctggtccatatttgccagggacaca
acccccaatggggatggaactaacctgtatggtacacagacattcttcctgtgccttgaa
gatgctagtggattgtcctttggagtgtttctgatgaacagcaatgccatggagattgtc
ctccagcccacaccagctgtcacctaccgtgccatcgggggcattctcgacttctatgtg
ttcctgggaaacactccggagcaagttgttcaagagtatctagagctcatcgggcgacca
gctctacctgcctactggacgcttggctttcacctcagtcgttatgactacggaagccta
gacaacttgaaagaagtcgtggacagaaactgggctgcacagctcccttatgatgttcag
catgccgatattgattatatggatgagaggaaggacttcacttataatccagtagatttc
aaaggctttcctgagtttgctaaggagttacacaataacggacagaaattggtcatcatc
gtggatccggctatctccaacggctcttccccaagtaatccctatggcccatatgacagg
ggttcagatatgaagatatgggtgaatgcttcagatggagtgacgccactcattggggag
gtctggcctggaaaaactgtgtttcctgattataccaaccccaagtgtgctgtttggtgg
gctaatgagtttgagcttttccacaaccaagtggaatttgatggaatctggattgacatg
aatgaagtctccaacttcgttgatggttcactttcaggatgttccacaagcaatctcaat
tatcccccattcactcccagagtcctggatgggtacctgttctgtaagaccctctgcatg
gatgcagtgcagcactggggcaagcagtatgatgtccacaatctgtatggctactccatg
gccattgccactgcagaagctgtcaaaactgtgttccccaataagagaagcttcatcata
acccgttctacctttgcgggatccggcaagtttgcagcccactggttaggagacaacgcg
gccacctggaatgacctccgctggtccatccccggcgtgctcgagttcaaccttttcggc
atcccgatggtgggtcctgacatatgtggctacgcactggatgcccctgaggagctttgc
aggcggtggatgcagctgggagcattctatccattttccaggaatcacaacggccaaggc
tacaaggcccaggatcctgcctccttcggagctgactccctgctgttgaattcctccaga
cactacctcagcatccgctacactctgctgccctatctctacaccctcttctatcgcgcc
catagccggggggacacagtggccaggccccttctgcacgagttctacagggacagcagc
acgtgggatgtgcaccagcagtttttatgggggcccggcctcctcatcactccagttctg
catgagggtgcagagaaagtgatggcctatgtgcccgatgccgtctggtatgattatgag
actgggggccaagtgagatggaggaaacagaaagtggagatggagcttcccggagacaaa
attggacttcaccttcgaggaggctacatctttcctacccagcagccagctataaccact
gcagccagtcgccggaaccctctcggtctcatcattgccctagatgataacaaagaagca
aaaggggagcttttctgggacgatggggaaacaaaagatactgtggccaataaagtttat
ctcttctgtgagttttccgtcactcaaaaccgcttggatgtgaagattttgcagtcaacc
tacaaagaccccaataatttagtttttaaagagattaaaatccttggaacccaggaacct
aacaacattacagtgaaacataatggcgtctcaagtcaagtttctcctaatgtcacttat
gattctaacctacaggtggcccttatcacaggacttgacctcgtcctgggagaagtatac
acggtggaatgggacctgaaaatacaggatgcagaaaaaatagactgttatccagatgag
aacggtgcttctgcagaaaactgtgttgcgcgtggctgtgcctgggaggcacccggttct
cctggagtccctttttgctatttcgtcgaagatctgtactctgtcagtgatgttcagtat
gactctcatagggccacagcggtcatctccttaaagtctgctctttatgccaacgctttt
ccctcaacacctgtgagccccctccgtctgagtgtgacctaccacaagaatgacatgctg
cagtttaagatttatgaccccagcaacaatcggtatgaagtcccagtccctctcaacgta
cccagggttccatccagcacctccgagggccaactctatgatgtcctcattaagaagaat
ccatttgggattgaaatccgccggaagagtacgggcaccgcaatttgggattctcagctc
cttggcttcacgttcaacgacatgttcatccgcatctccacccgccttccctcccggcac
atctatggctttggagaaaccgagcacacagcgtaccgacgggacttgaactggcacacg
tggggcatgttttcccgagaccagcccccggggtacaagaagaattcctacggcgtccac
ccctactacctggcactggaggaggatggcagtgcccacggagtgctcttgctgaacagc
aatgccatggatgtgacattccagcccacgcctgccctgacatactgtaccacaggagga
gttctggacttttatgtgttcttggggccaactccagagcttgtcactcagcagtacact
gagttgattggtcgtccagtgatggttccttactgggccttagggttccaactgtgtcgc
tatggataccagaatgactctgagattgccagcttgtatgacgagatggtggctgcccag
atcccctatgacgtgcagtactcggacattgactacatggagcgacagctggacttcacc
ctcagccccaagttcgctgggtttccagccctgatcgctcgcatgaaggccgacgggatg
cgggtcatcctcattctggacccggccatttccggaaacgagacccagccctaccttgcg
ttcactcggggtgtggagggtgacgtcttcatcaaagccccggctggcggaggcatcgtc
tggggaaaggtctggcccgattttcctgacgtcgtgataaatgggtctctagactgggag
agccaggtggagcgataccgagcttacgtggccttcccagactttttccgtaattcaact
gccacctggtggaagagggagttgagagaactatacaccaatccctgggagccggagaag
agtttgaagtttgatggcatatggattgatatgaatgaaccagcaagctttgtgaatggg
gcagttcctccaggctgcaaggacgccaccctgaaccgccctgcctacatgccgcatctg
gagtccagggacaagggtctgagcagcaagaccctgtgcatggagagcgagcagatcctg
gcggacggctcccgggtgcggcattacgacgtgcacagcctgtatgggtggtcccagacg
cggcccacctacgaagctgtgcaggaggtgacaggacagcgaggggtcgtcatcacccgc
tccacattcccctcttctggccgctggggaggacactggctgggagacaacacggctgcg
tgggaccagctgaggaaatctatcattggcatgatggagttcagcctctttggcatatcc
tatacaggagcagatatttgcgggttctttcaagatgccgaatatgagatgtgtgttcgc
tggatgcaactgggggccttctacccctttgcgaggaaccacaacaccattggaacaagg
aggcaagaccctgtgtcctgggatgataccttcatgaatatctccagaagtgtcctgcag
accagatataccctcttgccgtatctctacaccctcatgcacatggcgcacacggagggc
agtaccgtcgtgcggcctcttctccacgagtttgtgtcggaccatgtgacctgggatgta
gacagtcagttcctgctgggcccagctttcctggtcagccctgtcctggagcccaatgcc
agaaacgtcactgcgtatttccccagagcccgctggtacgatttctacacgggtgtggac
attcaagcaaggggagagtggaagtctttgccagcccctcttgaccacattaatcttcac
gtccgtgggggttacatcctgccctggcaagagcctgcacagaacacccacttcagccgc
cagaaattcctaggcttcaaggtggccttggacgatgaggggactgctacaggtcggctc
ttctgggatgatgggcaaagcattgatacctatgaaaatggactctattacctggcccac
ttttctgccagccagaatacgatggagagtcatgtaattttcaacaaatacatcaacgat
acaaaccctctgaaagtgggctacattgagatctggggagtggacagcgtccccatttcc
agtgtcagcgtctctgtgagcagcatggttataacacccaacttcacccacaaccctaca
acacaggtgttaagtatcgatgtgaccaacagaaacatcagcctacataatttcatttcc
ttgacatggagaagcactctgtga

DBGET integrated database retrieval system