KEGG   Pteropus alecto (black flying fox): 102898128
Entry
102898128         CDS       T02993                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X3
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04022  cGMP-PKG signaling pathway
pale04141  Protein processing in endoplasmic reticulum
pale04151  PI3K-Akt signaling pathway
pale04211  Longevity regulating pathway
pale04261  Adrenergic signaling in cardiomyocytes
pale04668  TNF signaling pathway
pale04728  Dopaminergic synapse
pale04911  Insulin secretion
pale04915  Estrogen signaling pathway
pale04918  Thyroid hormone synthesis
pale04925  Aldosterone synthesis and secretion
pale04926  Relaxin signaling pathway
pale04927  Cortisol synthesis and secretion
pale04928  Parathyroid hormone synthesis, secretion and action
pale04934  Cushing syndrome
pale04935  Growth hormone synthesis, secretion and action
pale05020  Prion disease
pale05030  Cocaine addiction
pale05031  Amphetamine addiction
pale05034  Alcoholism
pale05161  Hepatitis B
pale05163  Human cytomegalovirus infection
pale05166  Human T-cell leukemia virus 1 infection
pale05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102898128 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102898128 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102898128 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102898128 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102898128 (ATF6B)
   04915 Estrogen signaling pathway
    102898128 (ATF6B)
   04926 Relaxin signaling pathway
    102898128 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102898128 (ATF6B)
   04918 Thyroid hormone synthesis
    102898128 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102898128 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102898128 (ATF6B)
   04927 Cortisol synthesis and secretion
    102898128 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102898128 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102898128 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102898128 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102898128 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102898128 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102898128 (ATF6B)
   05031 Amphetamine addiction
    102898128 (ATF6B)
   05034 Alcoholism
    102898128 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102898128 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102898128 (ATF6B)
   05161 Hepatitis B
    102898128 (ATF6B)
   05163 Human cytomegalovirus infection
    102898128 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pale03000]
    102898128 (ATF6B)
Transcription factors [BR:pale03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102898128 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB bZIP_Maf GIT_CC DUF4407 YabA Docking
Other DBs
NCBI-GeneID: 102898128
NCBI-ProteinID: XP_006904685
UniProt: L5L5A9
LinkDB
Position
Unknown
AA seq 717 aa
MGRGGPWEPSHGCGGRGVKMAELMLLSEIADPTRFFTDNLLNPEDWDCTLYTGLDEVAEE
QTQLFRCPEQDVPFGSSMLDVGMDVSLPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSES
SHLSTEPSSQASGVGEVLVVKIESLAPPLCLLRDDSTPPFETIHINVGPTSDNPSDVHTK
IEPVSPSSSVNSEASLLSAESPNQDFIGEILEVKTESPSPQECLLQDVPGPPPGAFQISM
SPSPDGSSGKALPTRKPPLQPKPVVITTVPVPPRAMPPSTTVLLQPLVQPPPVSPVVLIQ
GAIRVQPEGPPPPAPRPERKSIVPAPMPGNSCPPEVDTKLLKRQQRMIKNRESACQSRRK
KKEYLQGLEARLQAVLADNQQLRRENAALRRRLEVLLAENSELKLGSGNRKVVCIMVFLL
FVAFNFGPVSISEPPLAPVSPGMSREAPRPRRHLLEFSAQLPVHGVETLKGSQGPEESQP
SPEGWPGFRNLTAFTRGAKELLLRDLDQLFLSSDCRHVNRTESLRLADELSGWVQRHQRG
RRKLPQRAQERQKSQLQKTSPPVKAVPTQPPGPLERDSVGQLQLYRHPDRSQPEFLDAID
RREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETVSGRGAPGDYEEMMQIE
CEVMDTRVIHIKTSTVPPSLRKQPSSTPGNTTGGPLPASAAGQAPQATHRPLYLNHP
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggggagaggcgggccttgggaaccgtctcatggttgtggggggcggggggtaaaaatg
gcggagctcatgctcctcagcgagattgcggacccgacgcgtttttttacagacaacttg
ctgaacccggaggactgggactgcaccttgtataccggcctggatgaagtggctgaggag
cagacgcagctctttcgttgtccggagcaggatgtcccgtttggcagcagcatgctggat
gtgggaatggatgtcagcctccctgaacccccatgggaccccctgcctatcttcccagat
cttcaggtgaagtcggagccatcctctccctgctcttcctcttctctcagctcggaatca
tcacatctttccacagagccctccagccaggcctctggtgtgggggaggtgctggttgtg
aagatagagtccttggcacctccactctgcctcctgagagatgattcaacacccccattt
gaaaccatccatatcaatgtgggccccacctctgataatccctcagatgtccataccaag
atagaacctgtttctccatcttcctccgtcaactctgaggcttccctgctctcagcagag
tctcccaaccaggattttataggagagatactagaagtgaagacagagtctccatcccct
caagagtgtctcctgcaggatgtcccaggccccccacctggagctttccagattagcatg
agtccatcccccgatggatcctcaggcaaagccctgcccacccggaagccaccactgcag
cccaaacctgtggtgataaccactgtcccagtgccacccagagctatgcctcccagcacc
accgtccttttgcagccccttgtccagccacccccagtgtccccagttgtcctcatccaa
ggtgctattcgagtccagcctgaagggccgcccccgcctgctccacggcctgaaaggaag
agcattgttccagctcctatgcctgggaactcctgccctcctgaagtggatacaaagctg
ctgaagcggcagcagcgaatgatcaagaaccgggagtccgcttgccagtcccggaggaag
aagaaagagtacctgcagggtctggaagctcggctgcaggcggtgctggctgacaaccag
cagctgcgccgggagaatgctgccctccggcggcgactggaggtgctgctggctgagaac
agcgagctcaagttagggtctggaaacaggaaggtggtctgcatcatggtcttcctgctc
ttcgttgccttcaacttcgggcctgtcagcatcagtgagccaccattggctcctgtctct
cctgggatgagcagagaggcgcctcgaccccggagacacttgctagaattctcagcgcaa
ttgccggttcatggggttgaaacccttaagggttcccagggccctgaggagtcccagccc
agccctgaaggctggccaggtttcaggaacctgacagccttcaccaggggtgccaaggaa
ctgctgctaagagacctggaccagctcttcctctcctctgactgccggcacgtcaaccga
actgagtccctgaggcttgctgacgagctgagtggctgggtgcagcgccaccagagaggc
cggcggaagctccctcagagggcccaggagagacagaagtctcagctacagaagacatcg
cctccagttaaggcagtccccacccaaccccccgggcccttagaaagggattctgtaggc
caactgcagctgtatcgccacccagaccgttcacagccagaattcctggatgcgattgac
cgacgagaagacacattttatgttgtctccttccgacgagaccacttgctgctcccagcc
atcagccacaacaagacctctcggcctaagatgtccctggtgatgcccgccatggccccc
aatgagacggtgtcaggccggggggcccctggggactatgaggagatgatgcagatcgag
tgtgaggtcatggacaccagggtgattcacatcaagacctccacagtgcccccttcactc
cgaaaacagccgtcctcaaccccaggcaataccacaggtggccccctgccagcttccgca
gctggccaggccccccaggccacccatcggcccctctacctcaatcatccctga

DBGET integrated database retrieval system