KEGG   Pteropus alecto (black flying fox): 102898264Help
Entry
102898264         CDS       T02993                                 

Gene name
CASKIN1
Definition
(RefSeq) caskin-1
  KO
K21952  CASK-interacting protein
Organism
pale  Pteropus alecto (black flying fox)
Brite
KEGG Orthology (KO) [BR:pale00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102898264 (CASKIN1)
Membrane trafficking [BR:pale04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102898264 (CASKIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caskin-Pro-rich SAM_1 Ank_2 Caskin-tail Ank_5 SAM_2 Ank_4 Caskin1-CID Ank Ank_3 SH3_2 SH3_1 SH3_9 NCD1
Motif
Other DBs
NCBI-GeneID: 102898264
NCBI-ProteinID: XP_024904175
LinkDB All DBs
Position
Unknown
AA seq 1296 aa AA seqDB search
MRPLHYAAWQGRKEPMKLVLKAGSAVNIPSDEGHIPLHLAAQHGHYDVSEMLLQHQSNPC
MVDNSGKTPLDLACEFGRVGVVQLLLSSNMCAALLEPRPGDTTDPNGTSPLHLAAKNGHI
DIIRLLLQAGIDINRQTKSGTALHEAALCGKTEVVRLLLDNGINAHVRNTYSQTALDIVH
QFTTSQASKEIKQLLREASAALQVRATKDYCNNYDLTSLNVKAGDIITVLEQHPDGRWKG
CIHDNRTGNDRVGYFPSSLGEAIVKRAGSRAGTEPSPPQGGSTSGPSAPPEEIWVLRKPF
AGGDRSGSLSSVAGGRSSGAHTLHAGSEGVKLLATVLSQKSVSESSPGDSPIKPPEGSTG
AARSQPPVAHAGQVYAEQPPKKLELASEGKSAEAVSQWLATFQLQLYAPNFLSAGYDLPT
ISRMTPEDLTAIGVTKPGHRKKITAEISSLSIPDWLPEHKPANLAVWLSMIGLAQYYKVL
VDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELQKAEYAKYEGGPLRRKA
PQSLEVMAIESPPPPEPAPADCQSPKMTTFQDSELSGELQAAMTGPAEGAATATAEKPSN
HLPPTPRASMRQEPSLGGRARHMSSSQELLGDGPPGPGSPMSRSQEYLLDEGAAPGTPPK
EARPSRHGHSVKRASVPPVPGKPRQVLPTGASPFTPPQTPTKARPGSPQAPGGTHGPAPA
TAKVKPTPQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPVESESGPAAPGPVPAPVPTPV
PMLCLPPEADVEPGRPKKRAHSLNRYAASDSEPERDELLVPAAVGPYATVQRRVGRSHSV
RAPANADKNVNRSQSFAVRPRKKGPPPPPPKRSSSAMASANLADESAPDAETEGSGTENG
RLGVRAQRRRASDLAGSVDTGSAGSVKSIAAMLELSSIGGGGRAARRPPEGHPTPRPASP
EPGRVATALASVKHKEAIGPDGEVVNRRRTLSGPVTGLLATARRGPGEPVGPADHSHFVE
EGTARQRPRGPAKGEASGEGPPLARVEASATLKRRIRAKQSQQENIKFILTESDTVKRRP
KAKEREAGLEPPPPLSVYQNGTGTVRRRPASEQAGPLELPPPPPPTEPPPSDLMHLPPLP
PPDSDARKPAKPPVSPKPVLAQPVPKIHGSPTPASKKVPLPGPSSPEVKRAHSTPPPPVS
PKPPPPPTAPKPVKVAAAVSPAAPDGASPVDSARQKLEETSACLAAALQAVEEKIRQEDT
QGLRPSAAEEKSTGSILDDIGSMFDDLADQLDAMLE
NT seq 3891 nt NT seq  +upstreamnt  +downstreamnt
atgcggccattgcactatgcggcctggcagggccggaaggaacccatgaaactggtgtta
aaggcgggctcggcagtgaacatcccatcggatgagggccatatccccctccacctggca
gcccagcatggtcactacgatgtgtctgagatgctgctccagcaccagtccaacccatgt
atggtggacaactcggggaagacgcccctggacctggcctgtgagttcggccgtgttggg
gtggtccagctactcctaagcagcaacatgtgcgcagccttgctggagccccggccaggg
gacaccactgaccccaatggcactagtcccttgcacctggcagccaagaacggccacatt
gacatcatcagactcctcctccaagctggcattgacattaaccgccagaccaagtccggc
acagccctccacgaggccgcactctgtgggaagacagaagtggttcggctgctgctggac
aatggaatcaacgcccacgtgaggaacacctacagccagacagccctggatatcgtgcac
cagtttaccacatcccaggccagcaaggagatcaagcagctgctacgagaggcctctgcg
gctctgcaggtccgggcgaccaaggattactgcaacaattatgatctgaccagcctcaat
gtgaaagctggggatatcatcacagtccttgagcagcatccagatggccgatggaagggc
tgtatccatgacaaccggacgggcaatgaccgagtgggctatttcccgtcctccctggga
gaggccattgtcaagcgagcaggttcccgagcaggcactgaaccaagcccaccccaggga
ggcagcacatcgggaccctctgcaccccctgaagagatctgggtgctgaggaagcctttt
gcaggtggggaccgcagtggcagcttgagcagtgtggctggtggccggagcagtggggcc
cacaccctgcacgcaggctctgaaggggtcaagctcttggcaacagtgctttcccagaag
tctgtctccgagtccagccctggggacagtcccatcaagcctccagagggctccacaggt
gcagcccggtcccagcctccagtggcccatgctgggcaggtctatgcggagcagccaccc
aagaagctggagctggcgtcggaaggcaagagcgctgaggctgttagccagtggctcgcc
acgttccagctacagctgtatgcacccaatttcctcagcgctggctatgacctgcccacc
atcagccgtatgacccctgaggacctcacagccattggggtcaccaagccaggccatcgg
aagaagatcacggcagagatcagcagcctgagcattcctgactggctgcctgagcacaaa
cccgctaacctggccgtgtggctgtccatgatcggcctagcccagtattataaggtactg
gtggacaacggctacgagaacattgacttcatcactgacatcacctgggaggacctgcag
gagattggaatcaccaagctgggacaccagaagaagctgatgctggcagtgaggaaactg
gcagagctgcagaaggcagagtacgccaagtatgaggggggacccctgcgccggaaggca
ccacagtcacttgaagtgatggctattgagtcgccgcccccacctgagcctgccccagct
gactgccagtctcctaagatgaccaccttccaggacagcgagctcagtggtgagctacag
gctgccatgactggcccagcagaaggggctgctaccgccactgctgaaaaaccctccaac
cacctgccgcccaccccaagggcttccatgcgtcaggagcccagcctgggtgggcgggca
cggcacatgagcagctctcaggagctgttgggtgatggaccccctgggcctggcagcccc
atgtcacgaagccaggagtacctgctggatgagggggcagcccctggcactccacccaag
gaggctcggcccagccgccacggccacagtgtcaaacgggccagtgtgcccccagtgccc
ggcaagccacgacaggtccttccaacaggtgccagcccctttacgcccccccagactccc
actaaagcccggccaggttccccccaggccccaggggggactcatggtccagccccagcc
acagccaaggtgaagcccaccccgcagttgctgccaccaacagaacgacccatgtcaccc
cgctcgctgcctcagtcacctacacaccgtggctttgcctatgtgctgccccagcccgtg
gaaagtgagtcagggccagctgctccggggcctgtacctgcacctgtgcccacacctgtg
cccatgctatgcctgccccctgaggctgatgtggagccagggcggcccaagaagcgcgcc
cacagcctgaatcgttatgcagcatctgacagtgagccagagcgtgacgagctgctggtc
ccagctgctgtggggccctatgccacagtccagcggcgtgtgggccgaagccactctgtg
cgggcacctgccaacgctgacaagaatgtcaaccgcagccagtccttcgctgtgcggccc
cgaaagaaggggcctccaccacccccaccgaagcgctctagctcagccatggccagtgcc
aacttggctgatgagtcggcaccagatgctgagactgaggggtctgggaccgagaatggc
cggctgggggtccgggcacaacgccggcgggctagtgacctggctggtagtgtggacaca
ggcagtgccggcagtgtgaagagcattgcagccatgcttgaactgtcatccattgggggt
gggggccgggcagcccgtaggccccctgagggacaccccacacctcgccctgccagccca
gagccaggccgggtagccacagccttggcctcagtgaagcacaaggaggccattgggcct
gatggtgaggtggtaaaccggcgccgtacgctcagtgggcccgtcacaggacttctggcc
actgcccgccgagggcctggggaaccagtggggcctgcagatcacagccactttgtggag
gaaggcaccgcccggcagcggccccgaggtccagccaaaggtgaggcgagtggggagggc
ccgcccttggcccgggtggaagccagtgccacactcaagaggcgcatccgagccaagcag
agccagcaggagaacatcaagttcatcctgactgagtccgacacagtcaagcgccggccc
aaggccaaggagcgggaggcaggtctcgagccacccccaccactgtctgtgtaccagaat
ggcacaggcactgtgcgccgccgaccagcctctgagcaggctgggcccctggagctgccc
ccaccaccaccacccaccgagccccctccctccgacctgatgcacttgcccccactgccc
ccaccagacagtgatgcccggaagccagccaagccacctgtctctcccaagcctgtcctg
gctcagccggtgccgaagatccacgggtcacccacacctgcctccaagaaggtgccactg
ccaggtcccagcagtccagaggtgaagcgtgcccacagcacgccgccgccgcctgtgtct
cccaagccgccgccgccgcccacggcgcccaaaccggtcaaggtcgcggccgccgtgtcc
cccgctgcgcctgacggcgcctcgcctgtagacagcgcccggcagaagctggaggagaca
agcgcgtgcctggcggcggcgctgcaagctgtagaagaaaagatacggcaggaagacacg
caaggcctacgcccctcggccgcggaagagaagagcacgggcagcatcctggacgacatc
ggcagcatgttcgatgatctggcggaccagctggacgccatgctggagtga

DBGET integrated database retrieval system