KEGG   Pteropus alecto (black flying fox): 102898392
Entry
102898392         CDS       T02993                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale01524  Platinum drug resistance
pale03430  Mismatch repair
pale03460  Fanconi anemia pathway
pale05200  Pathways in cancer
pale05210  Colorectal cancer
pale05213  Endometrial cancer
pale05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    102898392 (MLH1)
   03460 Fanconi anemia pathway
    102898392 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102898392 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102898392 (MLH1)
   05226 Gastric cancer
    102898392 (MLH1)
   05213 Endometrial cancer
    102898392 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102898392 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pale03400]
    102898392 (MLH1)
DNA repair and recombination proteins [BR:pale03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     102898392 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 102898392
NCBI-ProteinID: XP_006905820
LinkDB
Position
Unknown
AA seq 756 aa
MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRANYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVADVRTLPGATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMKGYISNANYSVKKCIFLLFINHRLVESASLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILDRVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEVV
KSTTGVTLSSTSGSGDKVYAHQMVRTDSREQKLDAFLQPGSKALSSQPQVVVPEDRTDTS
SAKQQDEEMLEIPAPADVAAKSQSSEGVAPKGASETSEKGASPPSLGNPRKRHREDSDVE
MVEDESRKEMTAACTPRRRIINLTSVLTLQEEINERGHETLREMLHNHSFVGCVNPQWAL
AQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEE
DGPKEGLAEYIVEFLKKKTEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRL
ATEVNWDEEKECFESLSKECAMFYSIRKQYVSEESTLSGQQSEVPGSTVNPWKWTVEHIV
YKAFRSHLLPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgtcgttcgtagcgggcgttattcggcggctggacgagaccgtggtgaaccgcattgcg
gcaggggaagttattcagcgtccagctaatgccatcaaggagatgattgagaactgttta
gatgcaaaatccacaagtattcaagtggttgttaaagaaggaggcctgaagttgattcaa
atccaagataatggcactggaatcaggaaagaagatctggatattgtgtgtgagaggttt
actacaagtaaactgcagtcctttgaggatttagctagtatttctacctatggttttcgg
ggtgaggctttggccagcataagccatgtggctcatgtcactattacaaccaaaacagct
gatggaaagtgtgcatacagagcaaattactcagatggaaagctgaaagctcctcctaaa
ccatgtgcaggcaatcaagggacccagatcacggtggaggaccttttttacaacatatcc
acgaggaggaaagctttaaaaaatccaagtgaagagtatgggaaaattttggaagtcgtt
ggcagatattcaatacataactcaggcattagtttctccgttaaaaagcaaggcgagaca
gtagccgatgttagaacactgcccggtgccacaactgtggacaatattcgctccatcttt
ggaaatgctgttagccgagaattgatagaagttggatgtgaggataaaacattagccttc
aaaatgaagggctacatatccaatgcaaactactcggtgaagaagtgcatcttcttactc
ttcatcaaccatcgtctggtagagtcagcctccttaagaaaagccattgaaacggtgtat
gcagcttatttacccaaaaacacacacccgttcctgtacctcagtttagaaatcagcccc
cagaatgtagatgtcaatgtgcaccccacaaagcacgaagttcacttcctccacgaggac
agcatcctggaccgggtgcagcagcacattgagagcaagctcctgggctccaactcctcc
aggatgtacttcacccagactttactgccaggccttgccggcccctcgggggaggtagtt
aaatccacaacgggtgtgaccctctcttctacttccggaagtggtgacaaggtgtatgcc
caccagatggtccgcacagattcccgggaacagaagctcgatgcctttctgcagcctggg
agcaaggccctgtccagtcagccccaggtcgttgtcccagaggacaggacagatacttct
agtgccaagcagcaggatgaggaaatgcttgaaatcccagctcctgctgacgtggctgcc
aagagtcagagctcggagggggtggcaccaaagggggcttcagaaacatcagagaaggga
gcatcccctcctagtctgggcaaccccagaaagagacatcgggaagactctgatgtggaa
atggtggaagacgagtcccgaaaagaaatgacagcagcttgtacccctcgtagaagaatc
attaacctcaccagtgttctgactctccaggaagaaattaatgagaggggacatgagact
ctccgggagatgctgcataaccactcatttgtgggctgtgtgaatcctcagtgggccttg
gcacagcatcagaccaagttataccttctcaacaccaccaaacttagtgaagaactgttc
taccagatactcatttatgattttgccaattttggtgttctgaggttatcggagccggca
ccgctttttgacctcgccatgctcgctctagacagtcccgagagtggctggacagaggaa
gatggccccaaggaaggacttgccgaatacatagttgagtttctgaaaaagaagactgag
atgctggcagactacttctctttggaaattgacgaggaagggaacctgattggattaccc
cttctgatcgacaactacgtgcccccattagagggtctgcctatcttcattcttcgacta
gccactgaggtgaactgggacgaagaaaaggaatgttttgaaagcctcagtaaagaatgt
gctatgttttactccatccggaagcagtacgtatctgaggagtcgacgctctcaggccag
cagagtgaagtgcctgggtcgacagtaaacccctggaagtggactgtggaacacattgtc
tataaagccttccgctcacaccttctgcctcctaaacatttcacggaagatggaaatatc
ctgcagcttgccaacctgcccgatctgtacaaagtctttgagaggtgttaa

DBGET integrated database retrieval system