KEGG   Pteropus alecto (black flying fox): 102898620
Entry
102898620         CDS       T02993                                 

Gene name
JAK3
Definition
(RefSeq) tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04062  Chemokine signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04217  Necroptosis
pale04550  Signaling pathways regulating pluripotency of stem cells
pale04630  JAK-STAT signaling pathway
pale04658  Th1 and Th2 cell differentiation
pale04659  Th17 cell differentiation
pale05161  Hepatitis B
pale05162  Measles
pale05166  Human T-cell leukemia virus 1 infection
pale05169  Epstein-Barr virus infection
pale05200  Pathways in cancer
pale05203  Viral carcinogenesis
pale05223  Non-small cell lung cancer
pale05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102898620 (JAK3)
   04151 PI3K-Akt signaling pathway
    102898620 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102898620 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102898620 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102898620 (JAK3)
   04659 Th17 cell differentiation
    102898620 (JAK3)
   04062 Chemokine signaling pathway
    102898620 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102898620 (JAK3)
   05203 Viral carcinogenesis
    102898620 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102898620 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    102898620 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102898620 (JAK3)
   05161 Hepatitis B
    102898620 (JAK3)
   05162 Measles
    102898620 (JAK3)
   05169 Epstein-Barr virus infection
    102898620 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pale01001]
    102898620 (JAK3)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102898620 (JAK3)
Protein kinases [BR:pale01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102898620 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo APH CARD
Other DBs
NCBI-GeneID: 102898620
NCBI-ProteinID: XP_015441664
UniProt: L5L7Y5
LinkDB
Position
Unknown
AA seq 1104 aa
MVPPSEETPLISQRSCSLSSSEAGVLHVLLPPRGPGPLQRLSFSFGDHSAEELCVRAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDTGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRNDLVSGRFHVGLGLKEQGECLSLAVLDLARMAREQAQR
PEELLKTVSYKACLPPGLRNLIQGLSFVTRRRIRRTVRQALCRVAACQADRHSLMAKYIM
DLERLDPARAAETFLVGLPGVAGGQDAPGLLHVAGDSGIAWSSGEQEVFQPFCDFPEIVD
ISIKQALRVGTAGEHRLVTVTRTDNQILEAEFPGLPAALSFVALVDGYFRLTVDSRHYFC
KEVAPPRLLEEVAQQCHGPITLDFAINKLKMGGSLPGSYVLRRSPQDFDSFLLTVCVQTP
LGPDYKGCLIRCDPTGAYSLAGLGRPHSSLRELLAACWDGGLHVDGVALNLTFCCTPRPK
EKSNLIVVRRGCSPPTSSPVQPHSGCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEAMDGEPRKTEVLLKVLDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFVHLGALDTYLRKCGQLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
EGSPPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFS
GVTMPISTLDPAKKLQFYEERQQLPAPKWMELALLIQQCMAYEPGHRPSFRAVIRDLNNL
ITSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLGAGRLLLYASQICKGMEYLGSCRCVHRDLAARNILVESE
THVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYSDKSCSPSAEFLRMMGCERDIPALCRLLDLLAEGQRLPAPPACPGEVHELMKLCWAP
SPQDRPTFSALGPQLDALWSGSQG
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggtgcctccgagtgaggagacacccctgatctctcagcgctcttgcagcctctcatct
tcagaggctggtgtgctgcatgtgctgctgccacctcggggccctggacccctgcagcgt
ctatccttctcctttggggaccactcggctgaagagctgtgtgttcgggctgctaaggcc
agtggcatcctgcctgtgtaccactccctctttgctctggccacggaggacctgtcctgc
tggttccccccgagccacatcttctccgtggaggacacaggcacccaagtccttgtctac
aggctccgcttttacttccccaactggtttgggctagagaagtgtcaccgcttcgggctt
cgaaaggacttggctagtgccatccttgacctgccagttctggagcacctcttcgcccag
caccgcaatgacctggtgagcggccgcttccacgtgggccttggcctcaaggagcagggc
gaatgtctcagcttggcagtgctggacctggccaggatggcccgcgagcaggcccagcgg
ccagaggagctgctaaagaccgtcagctacaaggcctgcctgccccctggcctgcgcaac
ctgatccagggcctgagcttcgtgactcggaggcgcattcggaggactgtacgccaggcc
ctgtgccgcgtggccgcctgccaggctgacaggcactcgctcatggccaagtacatcatg
gacttggagcgactggacccggccagggccgctgagaccttcctcgtgggcctccccggg
gttgctggtggtcaggatgcaccggggctgctccacgtggctggtgacagcggcatcgcc
tggagttcaggagaacaggaggtcttccagcccttttgcgactttccagaaatcgtggac
atcagcatcaagcaggctctacgcgttggcacggccggggagcaccgcctggtcactgtc
accaggacagacaaccagatcctggaggccgagttccctgggctgcccgccgcgttgtcc
tttgtggcgctcgtggatggctacttccggctgactgttgactctcggcactacttctgc
aaggaggtagcaccgccgcggttgctggaggaggtggcgcagcagtgccatggccccatc
accctggattttgcaatcaacaagctcaagatgggggggtcccttcctggctcctacgtt
ctccgccgcagcccccaggatttcgacagcttcctcctcactgtctgtgttcagaccccc
ctgggccctgattacaagggctgcctcatccggtgtgaccccacaggagcctactccctg
gctggccttggccgaccccacagtagtctgcgagagctcctggcagcctgctgggatggt
gggctgcatgtggatggggttgcactgaaccttaccttctgctgcacccctagacccaaa
gaaaagtccaacctgattgtggtccggagaggttgcagcccacccacatcatcccccgtg
cagccccactcaggatgccagctgagtcagatgacatttcacaagatacctgctgacagc
ttggagtggcatgagaacctgggtcatggatccttcacgaagatttacaggggctgtcgc
cacgaggccatggatggggagccccggaagacagaggtgctgctcaaggtgttggatgcc
aaacacaagaactgcatggagtcattcctggaagcagcaagtttgatgagccaagtatcg
taccagcatctcgtgttgcttcatggcgtgtgcatggctggagacagcatcatggtgcag
gaatttgtacacctgggagcactggacacgtatctacgcaagtgtgggcagctggtgcca
gccagctggaagctgcaggtgatcaaacagctggcctatgccctcaactatctggaggac
aaaggccttccccatggcaatgtctcagcccggaaggtgctcctggctcgggaaggggct
gaggggagcccgcccttcatcaagctgagtgatcccggtgtcagccccactgtactaagc
ctggagatgctcactgacaggatcccctgggtagctcctgagtgtctccaggaggcccgg
acacttggcttggaagctgacaagtggggcttcggtgccacagtctgggaggtgttcagt
ggtgtcacgatgccaatcagtaccctggatcctgccaagaagctccagttttatgaggaa
cggcagcagctgcctgcccccaagtggatggagctggccctgctgatccaacagtgcatg
gcctacgagccaggccacaggccctccttccgcgccgtcatccgtgacctgaacaacctt
atcacgtcagactatgagctcctctcagaccccacacctggtgccttggcaccccgtgac
gggctgtggaatggcgcccagctctatgcctgccaggaccctactatctttgaggagaga
cacctgaagtatatctcacagctgggcaagggtaactttggcagcgtggaactatgtcgc
tatgacccgctgggagacaacacaggtgccctggtggccgtgaagcagctgcagcacagt
gggccagaccagcagagggacttccaacgggagatccagatcctcaaagccctgcacagt
gacttcattgtcaagtaccgtggtgtcagctatggcccaggccgtcagagcctgcggcta
gtcatggagtacctgcccagtggctgcctgagagatttcctgcagcggcaccgcgcacgc
ctcggcgccggccgcctgctcctctatgcttcgcagatctgcaagggcatggagtatctg
ggctcctgccgctgcgtgcaccgcgacctggcagcgcgtaacatcctggtggagagcgag
acgcacgtcaagatcgccgactttggcctcgccaagctgctgccgctggacaaagactat
tacgttgtccgcgagccaggccagagccccattttctggtacgccccggagtccctctca
gacaacatcttctcgcgccagtcggacgtctggagcttcggagtcgtcctgtacgagctt
ttcacctacagtgacaagagctgcagcccctccgccgagttcctgcggatgatgggttgt
gagcgagatatcccggctctttgccgcctcctggacctgctggcagagggccagaggctg
ccggcgcctccagcctgccctggagaggttcatgagctcatgaagctgtgctgggctcct
agcccgcaagaccggccgaccttcagtgccctcggaccccagctggatgcgctgtggagt
ggaagccaggggtag

DBGET integrated database retrieval system