KEGG   Pteropus alecto (black flying fox): 102898687Help
Entry
102898687         CDS       T02993                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04068  FoxO signaling pathway
pale04146  Peroxisome
pale04211  Longevity regulating pathway
pale04213  Longevity regulating pathway - multiple species
pale05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102898687 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102898687 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    102898687 (SOD2)
   04213 Longevity regulating pathway - multiple species
    102898687 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    102898687 (SOD2)
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102898687 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 102898687
NCBI-ProteinID: XP_006915094
LinkDB All DBs
Position
Unknown
AA seq 222 aa AA seqDB search
MLSRAACSTSRKLATALGSLSSRQKYTLPDLPYDYGALEPHINAQIMELHYTKHHAAYVN
NLNATENKYLEALEKGDLSTQIALQPALKFNGGGHINHTIFWTNLSPNGGGEPKGELLEV
IKRDFGSFAKFKEKLTTVSAGVQGSGWGWLGFNKEQGRLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWDNVTERYMACKQ
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcccgggcggcgtgcagtacgagccggaagctggcgacggctctggggtccctg
agttccaggcagaagtacacccttcccgacctgccgtacgactatggcgccctggagcct
cacatcaacgcgcagatcatggagctgcactacacaaagcaccacgcggcctatgtgaac
aacctgaatgccaccgagaacaagtacctggaggcgctggagaagggtgatcttagtact
cagatagctcttcagcctgcactgaagttcaatggtggaggccatatcaaccacaccatt
ttctggacaaacctgagccctaatggcggtggagaacccaaaggagaattgctggaagtc
atcaaacgtgactttggttcctttgccaaatttaaggagaagttgacgactgtatctgct
ggtgttcaaggctcaggttggggttggcttggtttcaataaggaacagggacgcttacag
attgccgcttgtcctaaccaggatcccctgcaaggaacaacaggtcttattccactgctg
gggattgatgtgtgggagcatgcttattatcttcagtataaaaatgtcagacctgattat
ctaaaagccatttggaatgtaatcaactgggataatgtaactgaaagatacatggcttgc
aaacagtaa

DBGET integrated database retrieval system