KEGG   Pteropus alecto (black flying fox): 102898762
Entry
102898762         CDS       T02993                                 

Gene name
TSC2
Definition
(RefSeq) tuberin isoform X11
  KO
K07207  tuberous sclerosis 2
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04072  Phospholipase D signaling pathway
pale04115  p53 signaling pathway
pale04140  Autophagy - animal
pale04150  mTOR signaling pathway
pale04151  PI3K-Akt signaling pathway
pale04152  AMPK signaling pathway
pale04211  Longevity regulating pathway
pale04218  Cellular senescence
pale04714  Thermogenesis
pale04910  Insulin signaling pathway
pale04919  Thyroid hormone signaling pathway
pale05163  Human cytomegalovirus infection
pale05165  Human papillomavirus infection
pale05168  Herpes simplex virus 1 infection
pale05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pale00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102898762 (TSC2)
   04151 PI3K-Akt signaling pathway
    102898762 (TSC2)
   04152 AMPK signaling pathway
    102898762 (TSC2)
   04150 mTOR signaling pathway
    102898762 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102898762 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102898762 (TSC2)
   04218 Cellular senescence
    102898762 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102898762 (TSC2)
   04919 Thyroid hormone signaling pathway
    102898762 (TSC2)
  09149 Aging
   04211 Longevity regulating pathway
    102898762 (TSC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102898762 (TSC2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102898762 (TSC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102898762 (TSC2)
   05163 Human cytomegalovirus infection
    102898762 (TSC2)
   05165 Human papillomavirus infection
    102898762 (TSC2)
Protein phosphatases and associated proteins [BR:pale01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102898762 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Telomere_reg-2 Cnd1
Other DBs
NCBI-GeneID: 102898762
NCBI-ProteinID: XP_015446495
LinkDB
Position
Unknown
AA seq 1623 aa
MDVGLSSEFLMVLVNLVKFNSCYLDEYIASMVHMICLLCVQTVSSVDIEVSLQVLDAVVC
YNCLPAESLPLFIVTLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRAYME
DAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIK
KYRRELQAVTWDILLNIIERLLQQLQSLESPELRAIVHDLLTTVEELCDQNEFHGSQERY
FELIESCADQRPESSLLNLITYRAQSIHPAKDGWINNLQLLMERFFRSESRSAVRIKVLD
VLSFVLLINRQFYEEELINMVVISQLSHIPEDRDHQVRKLATQLLVDLAEGCHTHHFNSL
LDIIEKVIARSLSPPAELEERDVAAYSASLEDVKTAVLGLLVILQTKLYALPASHAMRVY
EMLVSHIQLHYKHSYTLPIASSIRLQAFDFLLLLRADALHRLGLPTKDGVVRFSPYCLCD
YMEPERGSEKKASGPLSPPTGPPGPAPVGPAVRLGSLPYSLLFRVLLQCLKQETDWKVLK
LVLSKLPESLRYKVLIFTSPCSVDQLSSALCSMLSGPKTLERLRGTPEGFSRTDLHLAVV
PVLTALISYHNYLDKARQREMVYCLEQGLIYRCASQCVVALAICSVEMPDIMIKALPILV
VKLTHISATASMAIPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVC
LAHHVIAMWFIRCRLPFRKDFVPFITKGLRSNVLRSFDDTPEKDSFRARSTSLNERPKSL
RIARPPKQGLNNSPPVKEFKESSAADAFRCRSISVSEHVVRSRIQTSLTSSSLGSADENS
MAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLI
TVTTSVGTGTRSLLGLDSGELQGSPELSSDPSMRVRQTKEAPAKLESQAGQQVCRGARDR
VRSMSGGHGLRIGALDTPASHFPGGPTLPGPQTAVVSKPEKASAGTQRPAQKEKTNLAAY
VPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKERRD
TALYKSLSVPAASSAKPPPPPRSNTDSAVVLEEGSPGETNLPVEPPELEDFEATLGTDRR
CQHAEAYSRSSSTSSQEEKSFHAEELPAGGIPIERAGPCKAARPSVDLSFQPSQPLSKSS
SSPELQTLQDILGDPGDKADVGRLSPEAKARSQSGILDGEGAAWSAPGEDSRGSAQPEGP
LPSNCPRSPSGLRPRGYTISDSAPSRRGKRVERDSFKSRAGASNAEKVPGINPSFVFLQL
YHSPFFGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSELAILSNEH
GSYRYTEFLTGLGKLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMP
TKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIITPLDYECNLVSLQ
CRKDMEGLVDTSVAKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRH
IKRLRHRIREEAHYSNPSLPLMQMHPPGHAKAPVQAPAEPMPTYETGQRKRLISSVDDFT
EFV
NT seq 4872 nt   +upstreamnt  +downstreamnt
atggatgttggcttgtcctcagaattccttatggtgcttgtgaacttggtcaaattcaac
agctgttacctcgatgaatacatcgcatcaatggtccacatgatatgcctgctgtgtgtc
cagactgtgtcttctgtggacatagaggtctctttgcaggtgctggatgctgtggtctgt
tataactgcctgccagcggagagcctccccctgtttattgtcaccctctgccgcaccatc
aatgtcaaggagctctgtgagccttgctggaagctgatgcgtaacctcctgggcactcac
ctgggccatagtgctatctacaatatgtgccgcataatggaggacagagcctacatggaa
gatgccccgctgctgagaggagctgtgttctttgttggcatggctctctggggagcccac
cgactctattctctcaagaactccccgacatctgtgttgccatcgttttatgaggccatg
acctgtccgaatgaggtggtgtcctatgagatcgtcctctccataaccagactcataaag
aagtacaggagggagctccaggctgtgacgtgggacattctgctaaacattatcgaacgc
ttgcttcagcagctccagagcctggagagcccggagctcagggccatcgtccacgaccta
ctgactacggtggaagagctttgtgatcagaatgaattccacggctcacaggagagatac
tttgagctcattgagagttgtgcggaccagaggcctgagtcctccctcttaaacttaata
acctacagggctcagtcaatccatccggcaaaagatggctggattaacaacctgcagttg
ctgatggagagattcttcaggagtgaatctcgcagtgctgtgcgcatcaaggtgctggat
gttctatcctttgtgctgctcatcaacagacagttctatgaggaggagctgatcaacatg
gtggtcatctcacagctctcccacatccctgaggacagagaccatcaggtccggaagctg
gccacccagttgctggtggacctggctgaaggctgccacacccaccacttcaatagcctg
ctggacatcattgagaaagtgatcgcccgctccctctctccacccgccgagctggaggaa
agagatgtggcagcatactcagcctccttggaggatgtgaagactgccgtcctggggctc
ctggtcatccttcagaccaagctgtatgccttgcctgccagccatgccatgcgtgtgtat
gagatgctcgtcagccacatccagctccactacaagcacagctataccctacccattgcc
agtagcattcggctgcaggcctttgacttcttgctgttgctgcgggctgatgcactacac
cgccttggcctgcccacaaaggatggggttgtgcggttcagtccctactgcctctgtgac
tacatggagccagagagaggctctgagaagaaggccagtggccctctgtcacctcccact
ggaccacctggcccagcacccgtaggccctgctgtgcgacttggctctttgccgtactcc
ctcctctttcgcgttctgctacaatgtttgaagcaggagaccgactggaaggtgctgaag
cttgtgctcagcaagctgccggagtcgctgcgctacaaggtcctcatttttacctctcca
tgcagcgtcgaccaactatcctccgccctctgctccatgctttcaggtcccaagaccctc
gagcggctcagaggcactccggaagggttctctagaaccgacctgcatctggctgtggtt
cccgtgctgacagctttgatctcttaccacaactacttggacaaagccagacagcgggaa
atggtgtactgcctggagcaaggcctcatctaccgctgtgccagccagtgcgtggtggcc
ctggccatctgcagcgtggagatgcctgacatcatgatcaaggccctgcccatcttggtt
gtgaagctcacgcacatctcagccacggccagcatggctattccacttcttgagttcctg
tcgactctggccaggttgccgcacctctacaggaactttgcagcagagcagtacgcaagc
gtgtttgccatctccctgccatataccaacccctccaagttcaatcagtatattgtgtgt
ctggcccatcacgtcatagctatgtggttcattaggtgccgcctgcccttccggaaagac
tttgttccgtttatcactaagggcctgcgctccaacgtcctccggtcttttgatgacaca
ccagagaaggacagcttcagagcgcggagcaccagtctcaacgagaggcccaagagtttg
aggatagccagaccccccaaacaaggcttgaataactctccacccgtcaaagaattcaag
gagagctctgcagccgatgccttccggtgccgcagcatcagtgtgtctgaacatgtggtc
cgcagcaggatccagacgtcccttacaagctccagcttgggatctgcagatgagaactcg
atggctcaggctgatgacaatttgaaaaatcttcacctagagctcacagaaacatgtctg
gacatgatggccagatacgtgttctcaaacttcacggcagtccccaagaggtcccctgta
ggagagttcctcctggccggtggcagaaccaaaacctggctggttgggaacaagcttatc
accgtgacgacaagcgtggggactggaacccggtcgctgctgggtctggactcaggagag
ctacagggcagcccagaattgagctctgaccccagcatgcgtgtgagacagacaaaggag
gcgccagccaagctagagtcccaggctgggcagcaggtgtgccgtggggcccgggaccgg
gtccgctccatgtctgggggccatggccttcgcattggtgccctggacactccagcctcc
cacttcccaggaggccccactttgccaggcccacagactgcagtggtcagcaagcctgag
aaggcctcagctggcacccagcgcccagcgcagaaagagaagacgaacctggcggcctac
gtacccctgctgacccagggctgggcggagatcttggtccggaggcccacagggaacacc
agctggctgatgagcctggagaacccgcttagccccttctcctcggacatcaacaacatg
ccgctgcaggagctgtccaacgcgctcatggctgccgagcgcttcaaggagcgccgtgac
acagctctgtacaagtcgctgtcagtgccggcggccagctcagccaagcctccgccaccc
ccacgttctaacacagactctgcggtggttctggaggagggaagtccaggtgagactaat
ttgccagtggagcccccggagttggaggacttcgaggcaacactaggcacagacagacgc
tgtcagcatgctgaagcttacagcaggtcatcttcaacctccagccaggaggagaagtcg
ttccacgcagaggagctgcctgctggggggatccccattgagcgagctggcccctgcaag
gcagcccggccctctgtggacctctccttccagccctcgcagcccctgagcaagtccagc
tcctcaccagaactgcagaccctgcaggacattcttggggaccctggggacaaggctgat
gttggtcggttgagccctgaggccaaggcccggtcacagtcagggatcctagacggagaa
ggtgctgcttggtcagccccaggcgaagacagccggggctctgcccagcccgagggtcct
ttgccttccaactgtccccgctcccccagtggcctgcggccccgaggctacactatttct
gattcagccccgtcacgcaggggcaagagggtggagagggattccttcaagagcagagct
ggggcctccaatgctgagaaagtaccaggcatcaaccccagcttcgtgttcctgcagctc
tatcattctcctttctttggtgacgagtccaacaagccaatccttttgcccaatgagtcc
ttcgaacggtcagtgcagctccttgaccagatcccgtcatacgacacgcacaagattgcc
gtcctgtacgtgggagaaggccagagcaacagtgagctcgccatcctatccaatgagcat
ggctcctataggtatacggaattcctgacaggcctgggcaagctcattgagcttaaggac
tgccagccagataaagtgtacctgggtggcctggatgtgtgcggcgaggatggccagttc
acctactgctggcacgatgacatcatgcaagctgtctttcacatcgctaccctgatgccc
accaaggacgtggacaagcaccgctgtgacaagaagcgccacctgggcaatgattttgtg
tccattgtctacaacgattctggcgaggacttcaaactgggtaccatcaaaggccagttc
aactttgtccatgtgattatcacccccctggactacgagtgcaacctggtgtcgctgcag
tgcaggaaagacatggagggcctcgtggataccagtgtagccaagatcgtgtctgaccgc
aacctgcccttcgtggcccgccagatggccctgcatgcaaatatggcctcgcaggtacac
cacagccgctccaaccccactgacatctacccctccaagtggattgccaggctccgccac
atcaagcgactccgtcaccggatccgtgaggaagcccactactcaaatcccagcctgccc
ctgatgcagatgcaccccccaggccacgccaaagccccagtgcaggccccagccgagccc
atgcccacctatgagacaggccagcggaagcgtctcatctcctccgtggatgacttcaca
gagtttgtgtga

DBGET integrated database retrieval system