KEGG   Pteropus alecto (black flying fox): 102898899Help
Entry
102898899         CDS       T02993                                 

Gene name
CLEC7A
Definition
(RefSeq) C-type lectin domain family 7 member A isoform X2
  KO
K10074  C-type lectin domain family 7 member A
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale04145  Phagosome
pale04625  C-type lectin receptor signaling pathway
pale05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pale00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102898899 (CLEC7A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102898899 (CLEC7A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102898899 (CLEC7A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pale04131]
    102898899 (CLEC7A)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pale04054]
    102898899 (CLEC7A)
   04090 CD molecules [BR:pale04090]
    102898899 (CLEC7A)
   04091 Lectins [BR:pale04091]
    102898899 (CLEC7A)
Membrane trafficking [BR:pale04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    102898899 (CLEC7A)
Pattern recognition receptors [BR:pale04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   102898899 (CLEC7A)
CD molecules [BR:pale04090]
 Proteins
  102898899 (CLEC7A)
Lectins [BR:pale04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   102898899 (CLEC7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C UL45 Ly49 Claudin_2 DUF1218
Motif
Other DBs
NCBI-GeneID: 102898899
NCBI-ProteinID: XP_006906898
LinkDB All DBs
Position
Unknown
AA seq 199 aa AA seqDB search
MEYLSEPENLDENGYTQLDFSSRNIARRPVFSEKGTYRASPHWRCIAVTLGILCLVMLVI
AVVLGTTGVLSSSCPPNWIIHETSCYLFSTSTDSWESSKRQCSQLGSNLLKIDSSKELEF
VRKQVSSQPDNSFWIGLSRHQTEGPWLWEDGSMFSSNLFQIRSTVSQENSSHNCVWIHMS
IIYDQLCSVPSYSICEKQL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggaatacctttctgagccagaaaatttggatgaaaatggatatactcagttggacttc
agctctcgaaatattgccagaagacctgtgttctccgagaaaggaacttacagggcatct
cctcattggcgttgcattgctgtgactctggggatcttatgcctggtaatgctggtgata
gctgtggtcctgggtaccacaggagttctttccagttcttgtccccctaactggattata
catgagactagctgttacctatttagcacatcaacagattcctgggagagtagtaaaaga
caatgctctcaactgggctctaatcttctgaagatagatagttcaaaagaattggaattt
gtaagaaagcaagtgtcttcccaacctgataattcattttggataggtctctctcgccat
cagactgagggaccgtggctctgggaagatggttcaatgttttcttctaacttgtttcaa
atcagaagcacagtttcccaggagaactcatctcacaattgtgtttggattcacatgtca
ataatttatgaccaactttgtagtgtgccctcatacagtatttgtgagaagcagctctag

DBGET integrated database retrieval system