KEGG   Pantoea alhagi: B1H58_05065Help
Entry
B1H58_05065       CDS       T05014                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
palh  Pantoea alhagi
Pathway
palh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:palh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B1H58_05065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:palh01002]
    B1H58_05065
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:palh01011]
    B1H58_05065
Enzymes [BR:palh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     B1H58_05065
   3.4.21  Serine endopeptidases
    3.4.21.-  
     B1H58_05065
Peptidases and inhibitors [BR:palh01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   B1H58_05065
Peptidoglycan biosynthesis and degradation proteins [BR:palh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   B1H58_05065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ARJ44203
UniProt: A0A1W6BAZ9
LinkDB All DBs
Position
1084351..1085784
Genome map
AA seq 477 aa AA seqDB search
MRFSRLVTGLTCAFMLQAQAAPVEEYTQYLPDGANLALMAQKVGSSTPLVDYHSKQMALP
ASTMKVVTALAALLELGPDFRFRTTLETQGKVDNGTLQGDLIARFGGDPTLSRQDLRNMV
TALTKQGITHIQGNLVIDTSVFASHDKAPGWPWNDNTQCFSAPPAAAIVDKNCFSVSLYS
ADRPDDNAFIRVASYYPVTMFSQVRTLAKGSPDAPYCELDVVPGELNRFTITGCMTQRSE
PLPLAFAIQDGAAWSGAILKAMLQDAGIDYTGHLVRQTRVTEPGTLLAETQSAPLRDLLK
VMLKKSDNMIADTVFRTIGRHYFNVPGTWRAGSDAVRRVLRQKANIDLGNSIQVDGSGLS
RHDLISPATMMQVLQYIAQNDQQLNFISMLPLAGYDGTLRYRGGLHEAGVDGKVSAKTGS
LSGVYNLAGFITTASGQRVAFVQFLSGYAVPPEDKRIRRVPLVRFESRLYKDIYQNN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgattttcacgacttgttaccggactaacctgtgcgtttatgctgcaagctcaggca
gcacccgtggaagaatacacacaatatttaccggatggcgcaaacctggcgctgatggca
caaaaagtgggttcatcaacgccgctggtcgattatcacagtaaacaaatggctttgcca
gccagcaccatgaaagtagtgacggcgctcgcagcgctgctggaattgggtccagacttc
cgctttcgcaccacgctggaaacgcagggcaaagtggataatggcaccctgcagggcgat
ctgattgcccgctttggcggcgatcctacgctttcacgccaggatttacgtaatatggtt
accgctctgaccaaacagggcattacccatattcagggcaatttggtgatcgatacctcg
gtcttcgccagtcacgataaagcgccaggctggccatggaacgataatactcagtgcttt
agcgcgccacctgccgctgctattgtggataaaaactgtttttccgtgtcgttgtacagc
gccgatcgtcccgacgataacgcctttattcgcgtagcgtcttattatccggttaccatg
ttcagtcaggtacgtacgttagcgaaagggtcgcccgatgcgccttactgcgaactggat
gtcgtaccgggcgagctgaaccgctttacaatcaccggctgtatgacgcagcgcagcgaa
cctttgccgctggcctttgctattcaggatggcgccgcctggtccggagccattttaaaa
gccatgctgcaggatgccggtattgattacaccggacatctggtgcgccaaacgcgcgtc
accgagccaggcactctcctggcggagacccagtccgcgccgctgcgtgatttgctgaaa
gtgatgctgaaaaaatcggacaatatgatcgccgatacggttttccgcaccatcgggcgt
cactatttcaacgtccctggcacctggcgtgcgggttcagatgcggtgcgccgtgttctg
cgccaaaaggcgaatatcgatcttggcaacagcatccaggtcgatggatccgggctatcg
cgtcacgatctgatctctccggcaaccatgatgcaggtgctgcaatatattgctcagaac
gatcagcagttgaactttatctctatgctgccgctggcgggctacgatggcacgttgcgc
tatcgcggcggtctgcatgaagcaggcgtggatggcaaagtttccgccaaaaccggttcg
ctgtcaggggtttataacctggccggttttattaccaccgccagcggtcaacgcgtggca
tttgtccagttcctgtccgggtatgccgtaccgccagaggacaaacgcatccgccgcgtg
ccgctggtgcgctttgaaagccggctatacaaagacatctatcagaataactga

DBGET integrated database retrieval system