KEGG   Pantoea alhagi: B1H58_06085Help
Entry
B1H58_06085       CDS       T05014                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
palh  Pantoea alhagi
Pathway
palh00564  Glycerophospholipid metabolism
palh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:palh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B1H58_06085
Enzymes [BR:palh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B1H58_06085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N Lycopene_cycl GIDA FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ARJ41627
UniProt: A0A1W6B3H4
LinkDB All DBs
Position
1275790..1277298
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRTGLFMYDHLGKRTSLPGS
KGLRFGADSVMKPEITRGFEYSDCWVDDARLVVLNAQEVVKRGGEVRTRTRVTRAWRENG
LWMVEAEDVDSGKTFTWRAKGLVNAAGPWVKQLFDDGLKLKSPYGIRLIKGSHIVVPRVH
TEKQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYKGDPKQVKIDDNEIAYLLKVYNAHF
KKQLDRSDIVWTYSGVRPLCDDESDSPQAITRDYTLDVRDDAGKAPLLSVFGGKLTTYRK
LAEHAMEKLAKYYSNIGPAWTKTAVLPGGDIAGTREDYAASLRRRYSFISEGMARHYART
YGSNSERILQNATSLSDLGEDFGHGFYEAELRYLMENEWVRELDDAIWRRTKLGMWLDEA
QQARVAQWLDAHGKKPTLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgatcgttatcggcggcggcatcaacggtgccggtattgcggcc
gacgccgcaggacgcggactgtcagtgctgatgctggaggcgcaagatctggcatgcgcg
acctcctccgccagctcgaaactgattcatggcggcctgcgctacctggaacattatgaa
ttccgtctggtcagcgaagcgctggccgagcgtgaagtgttgctaaagatggctccgcac
attgcctttcccatgcgtttccgcctgccgcaccgcccgcatttacgtccggcatggatg
atccgcaccggcctgtttatgtatgaccacttaggcaaacgcaccagtcttccgggcagt
aaagggctgcgtttcggcgcagattccgtaatgaagccggaaatcacgcgcggtttcgaa
tattctgactgctgggtcgacgatgcgcgtctggtggtgctgaacgctcaggaggtggta
aaacgcggcggcgaagttcgtacccgcacacgggtgactcgtgcatggcgtgaaaacggc
ctgtggatggtggaagcggaagatgtcgatagcggtaaaacctttacctggcgcgccaaa
ggcctggtcaatgccgctggcccgtgggttaaacagctgtttgacgacggcctgaagctg
aaatctccttacggcattcgcctgattaaaggcagccatattgtagtgccgcgcgttcac
acggaaaaacaggcttatattctgcagaacgaagaccatcgtatcgttttcgtgatcccg
tggatggatgagttttccatcattggcaccaccgatgtggaatacaaaggcgatccgaaa
caggtaaaaattgacgataatgaaatcgcctatctgctgaaagtgtataacgcacacttt
aaaaagcagctggatcgtagcgatattgtctggacctattccggcgtgcgtccgctgtgt
gatgacgaatctgactcaccgcaggcgattacccgtgattacacgctggatgtccgtgac
gatgcgggtaaagcgccgctgctgtcggtgttcggcggcaagctgaccacctaccgtaag
ctggctgaacatgcaatggagaaactggcgaagtactactccaatattggcccggcctgg
accaaaacagcagtgttgccgggcggtgatattgccggtacgcgtgaggattacgccgcc
agcctgcgtcgtcgttattcctttattagcgaaggcatggcgcgccattatgcccgcacc
tacggcagcaacagcgagcggatcttacagaacgccacttccctgagcgatctgggtgaa
gatttcggccacggtttctatgaggctgagctgcgctacctgatggaaaacgagtgggtg
cgcgaactggatgacgcgatctggcgtcgcaccaaacttggcatgtggctggatgaggct
cagcaggcgcgcgtggcgcagtggctggacgcgcacggcaaaaagccgacactctcgctg
gcgtcataa

DBGET integrated database retrieval system