KEGG   Pantoea alhagi: B1H58_09460Help
Entry
B1H58_09460       CDS       T05014                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
palh  Pantoea alhagi
Pathway
palh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:palh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B1H58_09460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:palh02000]
    B1H58_09460
Enzymes [BR:palh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     B1H58_09460
Transporters [BR:palh02000]
 Other Transporters
  Pores ion channels [TC:1]
   B1H58_09460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37 COR
Motif
Other DBs
NCBI-ProteinID: ARJ42218
UniProt: A0A1W6B544
LinkDB All DBs
Position
2003250..2003918
Genome map
AA seq 222 aa AA seqDB search
MIVVHHLNNSRSQRILWLLEELELPYEIRRYQRQANMLAPEALKQVHPLGKAPVISDGVR
VVAESGAILEYLAGRYDAQQRLTPQNEEQALQSRYWLHYAEGSLMPLVVMRLIFSRMGKP
PVPWLLRPIGAAFGNGVRKGFIDKQLATHRQFIERHLTTHSWFAGERLTLADFQMSFPVQ
GLAARGGLNNMPATQAWLANVMRRPAWQRAIQQGGELDLAAE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttgtccatcatctcaacaactcccgttctcagcgcatcctctggttactggaa
gagctggagctgccctatgaaatccggcgctatcagcgccaggcaaatatgctggcaccg
gaggcgctgaagcaggtgcatccgttggggaaagcgccggttatcagcgacggcgttcgc
gtagtggctgaatcgggcgcgattctggaatatctggcgggccgctacgatgcccaacag
cggttaacgccgcagaatgaagagcaagcgttgcagagccgttactggctgcactatgcg
gaagggtcgctgatgccgctggtggttatgcgtctgatcttcagcagaatgggcaagccg
ccggtgccctggctgttgcgtcccatcggcgcagccttcggtaacggcgtgcgcaaaggc
tttattgataagcagctggccacgcatcgtcagtttatcgagcgacatctgaccacccat
agctggttcgctggcgaacggcttacgctggcggattttcaaatgagctttcctgttcag
gggctggcggcgcgcggcgggttgaataatatgccggcaacgcaggcctggctggctaac
gttatgcgtcgtcccgcctggcagcgcgccattcagcagggcggcgagctcgatctggcg
gcggaatag

DBGET integrated database retrieval system